Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  HEAT repeat-containing protein 2  

UniProtKB / Swiss-Prot ID :  HEAT2_HUMAN

Gene Name (Synonyms) : 
HEATR2  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAALGVAEAVAAPHPAEGAETAEAVELSRALSRLLPGLEADSKPGRRRALEALRRALEEPGPAADPTAFQ...
Predicted Secondary Structure CCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCHHC...
Protein Variant
LocationDescription
560R -> C (in dbSNP:rs73258248). VAR_060463
632V -> A (in dbSNP:rs4720951). VAR_056911
743R -> K (in dbSNP:rs3922641). VAR_060464
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAALGV
---CCCCHH
16.05UniProtKB
Link-
43Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EADSKPGRR
HHHCCCHHH
52.63Phosphositeplus
Link-
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQWQKENEE
CCCCCCCHH
60.59Phosphositeplus
Link-
445Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSTLKKTPS
HHHHHCCCC
55.48Phosphositeplus
Link-
561Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DLYRKHIGP
HHHHHHHHH
26.47Phosphositeplus
Link-
655Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ETVTKDILA
HHHHHHHHC
38.13Phosphositeplus
Link-
701PhosphothreonineDVQETLMPQ
HHHHHHHHH
15.97HPRD
Link-
709PhosphothreonineQVLTTLEED
HHHHHHHHH
28.19HPRD
Link-
715Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEDSKMTRL
HHHHHHHHH
57.52Phosphositeplus
Link-
727PhosphothreonineRIINTFLKT
HHHHHHHHC
21.67HPRD
Link-
727PhosphothreonineRIINTFLKT
HHHHHHHHC
21.67Phosphositeplus
Link-
730Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NTFLKTSGG
HHHHHCCCC
36.13Phosphositeplus
Link-
740Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TDPEKLIRI
CCHHHHHHH
55.38Phosphositeplus
Link-
750Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PELLKRLDD
HHHHHHHHH
64.64Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
FEZ1_HUMANphysical interactionMINT-64842MINT16169070
FEZ1_HUMANphysical interactionEBI-734563
intact16169070
ZBT16_HUMANphysical interactionEBI-734566
intact16169070
ARF6_HUMANphysical interactionEBI-1062840
intact17353931
MAGA6_HUMANphysical interactionEBI-1072462
intact17353931
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures