Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Eukaryotic translation initiation factor 4H  

UniProtKB / Swiss-Prot ID :  IF4H_MOUSE

Gene Name (Synonyms) : 
Eif4h, Wbscr1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, perinuclear region. 

Protein Function :  Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA (By similarity). 

Protein Sequence MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSV...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
12PhosphotyrosineDDRAYSSFG
CCCCCCCCC
13.02PhosphoELM
Link-
12PhosphotyrosineDDRAYSSFG
CCCCCCCCC
13.02Phosphositeplus
Link-
12PhosphotyrosineDDRAYSSFG
CCCCCCCCC
13.02SysPTM
Link-
21PhosphoserineGGRGSRGSA
CCCCCCCCC
31.91Phosphositeplus
Link-
42PhosphotyrosineTEPPYTAYV
CCCCCEEEE
18.08Phosphositeplus
Link
42PhosphotyrosineTEPPYTAYV
CCCCCEEEE
18.08SysPTM
Link
45PhosphotyrosinePYTAYVGNL
CCEEEEECC
10.90PhosphoELM
Link
45PhosphotyrosinePYTAYVGNL
CCEEEEECC
10.90Phosphositeplus
Link
45PhosphotyrosinePYTAYVGNL
CCEEEEECC
10.90SysPTM
Link
93Caspase cleavage aspartic acidFDEVDSLKE
ECCHHHHHH
46.32Phosphositeplus
Link
217PhosphothreonineLKPRTVATP
CCCCCCCCC
24.03Phosphositeplus
Link-
230PhosphoserineANPNSAIFG
CCCCCCCCC
24.81Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures