Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Interferon beta  

UniProtKB / Swiss-Prot ID :  IFNB_HUMAN

Gene Name (Synonyms) : 
IFNB1, IFB, IFNB  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Has antiviral, antibacterial and anticancer activities. 

Protein Sequence MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHCCCC...
Protein Variant
LocationDescription
162C -> Y (in clone PF526, loss of abilityto form the essential disulfide bond,
164W -> C (in a breast cancer sample;somatic mutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
101N-linked (Glc...)STGWNETIV
CCCCCHHHH
37.57HPRD
Link
101N-linked (GlcNAc...).STGWNETIV
CCCCCHHHH
37.57UniProtKB
Link
140PhosphoserineKLMSSLHLK
CCCCHHHHH
13.07Phosphositeplus
Link
140Phosphoserine.KLMSSLHLK
CCCCHHHHH
13.07UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
INAR1_HUMANphysical interaction
physical interaction
DIP:10914EDIP7592797
10049744
INAR2_HUMANphysical interactionDIP:10919EDIP10395669
INAR1_HUMANin vivoHPRD:00972HPRD1834641
IFNB_HUMANin vitroHPRD:00972HPRD9342320
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.";
Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.;
Anal. Sci. 24:161-166(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures