Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Immunoglobulin-binding protein 1  

UniProtKB / Swiss-Prot ID :  IGBP1_HUMAN

Gene Name (Synonyms) : 
IGBP1, IBP1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (Potential). 

Protein Function :  Associated to surface IgM-receptor; may be involved in signal transduction. May be involved in regulation of the catalytic activity of type 2A-related serine/threonine phosphatases. 

Protein Sequence MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEE...
Predicted Secondary Structure CCCHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH...
Protein Variant
LocationDescription
20R -> K (in dbSNP:rs6625580). VAR_049570
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAEDE
---CCCHHH
21.40UniProtKB
Link
44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EKVFKGLDL
HHHHHHHHH
62.64Phosphositeplus
Link
145PhosphotyrosineSSMAYPSLV
HHHHHHHHH
5.68Phosphositeplus
Link
176Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LSAMKSAVE
HHHHHHHHC
34.67Phosphositeplus
Link
241Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RPPVKPFIL
CCCCCCHHH
39.73Phosphositeplus
Link-
241N6-acetyllysineRPPVKPFIL
CCCCCCHHH
39.73HPRD
Link-
241N6-acetyllysineRPPVKPFIL
CCCCCCHHH
39.73Phosphositeplus
Link-
241N6-acetyllysine.RPPVKPFIL
CCCCCCHHH
39.73UniProtKB
Link-
253Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MAQAKVFGA
HHHHHCCCC
26.47Phosphositeplus
Link-
287Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QGIAKAAPE
CCCCCCCCC
43.06Phosphositeplus
Link-
295Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EEFRKAAQQ
CCCCCCHHH
54.09Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TRI18_HUMANin vivo
yeast 2-hybrid
HPRD:02140HPRD11371618
11806752
PP2AA_HUMANENSP00000348784STRING
- top -

Disease Reference
Kegg disease
OMIM disease
300472Mental retardation, X-linked, syndromic, 28 (MRXS28)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-241, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures