Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ig gamma-1 chain C region  

UniProtKB / Swiss-Prot ID :  IGHG1_HUMAN

Gene Name (Synonyms) : 
IGHG1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :   

Protein Sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT...
Predicted Secondary Structure CCCCCCEEEEECCCCCCCCCCCEEEEEEEEEEECCCEEEEECCCEEECCEEEEEEEECCCCCEEEEEEEE...
Protein Variant
LocationDescription
97K -> R (in G1M(3) marker). VAR_003886
239D -> E (in G1M(non-1) marker). VAR_003887
241L -> M (in G1M(non-1) marker). VAR_003888
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
180N-linked (GlcNAc...)EEQYNSTYR
CCCCCCEEE
27.80SysPTM
Link-
180N-linked (GlcNAc...).EEQYNSTYR
CCCCCCEEE
27.80UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
KAC_HUMANphysical interactionMINT-24896MINT12552112
NEMO_HUMANphysical interactionMINT-48194MINT14743216
APOC1_HUMANphysical interactionEBI-1222317
intact15174051
K1C9_HUMANphysical interactionEBI-1222317
intact15174051
KAC_HUMANphysical interactionEBI-1222317
intact15174051
FGFR1_HUMANphysical interactionEBI-1222317
intact15174051
NU214_HUMANphysical interactionEBI-1222317
intact15174051
ELN_HUMANphysical interactionEBI-1222317
intact15174051
K2C1_HUMANphysical interactionEBI-1222317
intact15174051
TTHY_HUMANphysical interactionEBI-1222317
intact15174051
Q9NX17_HUMANphysical interactionEBI-1222317
intact15174051
SETB2_HUMANphysical interactionEBI-1222317
intact15174051
K1C16_HUMANphysical interactionEBI-1222317
intact15174051
OR8D2_HUMANphysical interactionEBI-1222317
intact15174051
Q8N355_HUMANphysical interactionEBI-1222317
intact15174051
PDPK1_HUMANphysical interactionEBI-1222317
intact15174051
FINC_HUMANphysical interactionEBI-1222317
intact15174051
FAS_HUMANphysical interactionEBI-1222317
intact15174051
HV303_HUMANphysical interactionEBI-1222317
intact15174051
K1C14_HUMANphysical interactionEBI-1222317
intact15174051
CAD12_HUMANphysical interactionEBI-1222317
intact15174051
HEP2_HUMANphysical interactionEBI-1222317
intact15174051
HV320_HUMANphysical interactionEBI-1222317
intact15174051
K1C10_HUMANphysical interactionEBI-1222317
intact15174051
PNMA2_HUMANphysical interactionEBI-1222317
intact15174051
K2C6A_HUMANphysical interactionEBI-1222317
intact15174051
IGLL1_HUMANphysical interactionEBI-1222317
intact15174051
FIBA_HUMANphysical interactionEBI-1222317
intact15174051
TENS3_HUMANphysical interactionEBI-1222317
intact15174051
CLUS_HUMANphysical interactionEBI-1222317
intact15174051
K2C5_HUMANphysical interactionEBI-1222317
intact15174051
RTKN2_HUMANphysical interactionEBI-1222317
intact15174051
ADA1B_HUMANphysical interactionEBI-1222317
intact15174051
SAA4_HUMANphysical interactionEBI-1222317
intact15174051
KLK3_HUMANphysical interactionEBI-1222317
intact15174051
CTR9_HUMANphysical interactionEBI-1222317
intact15174051
TITIN_HUMANphysical interactionEBI-1222317
intact15174051
PAPP1_HUMANphysical interactionEBI-1222317
intact15174051
SFR19_HUMANphysical interactionEBI-1222317
intact15174051
AOAH_HUMANphysical interactionEBI-1222317
intact15174051
K2C7_HUMANphysical interactionEBI-1222317
intact15174051
ICAM4_HUMANphysical interactionEBI-1222317
intact15174051
CERU_HUMANphysical interactionEBI-1222317
intact15174051
LAC_HUMANphysical interactionEBI-1222317
intact15174051
QTRD1_HUMANphysical interactionEBI-1222317
intact15174051
O75441_HUMANphysical interactionEBI-1222317
intact15174051
APOA1_HUMANphysical interactionEBI-1222317
intact15174051
Q9H956_HUMANphysical interactionEBI-1222317
intact15174051
LV102_HUMANphysical interactionEBI-1222317
intact15174051
TGM4_HUMANphysical interactionEBI-1222317
intact15174051
ARMC2_HUMANphysical interactionEBI-1222317
intact15174051
KAC_HUMANin vitroHPRD:11755HPRD11183784
1522589
CD40L_HUMANin vitroHPRD:11755HPRD11525169
FCG3B_HUMANin vitroHPRD:11755HPRD10917521
IGHG1_HUMANin vitroHPRD:11755HPRD10917521
11297532
12527303
4138920
7236608
955567
992566
- top -

Disease Reference
OMIM disease
254500Multiple myeloma (MM)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-180, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures