Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Interleukin-21 receptor  

UniProtKB / Swiss-Prot ID :  IL21R_HUMAN

Gene Name (Synonyms) : 
IL21R, NILR UNQ3121/PRO10273  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Single-pass type I membrane protein. 

Protein Function :  This is a receptor for interleukin-21. 

Transmembrane Topology (topPTM) : IL21R_HUMAN 

Protein Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRS...
Predicted Secondary Structure CCCCHHHHHHHHHHHCCCCCCCCEEEECCCCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCEEEEECC...
Protein Variant
LocationDescription
191R -> C (in dbSNP:rs3093370). VAR_014360
318S -> R (in dbSNP:rs3093385). VAR_014361
484G -> S (in dbSNP:rs3093386). VAR_014362
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
73N-linked (GlcNAc...).RSAHNATHA
CCCCCCEEE
46.37UniProtKB
Link
214C-linked (Man).YQGTWSEWS
CCCCCCCCC
10.90UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
JAK1_HUMANin vivoHPRD:05649HPRD11016959
11418623
IL2_HUMANENSP00000338010STRING
IL4_HUMANENSP00000338010STRING
IL7_HUMANENSP00000338010STRING
IL21_HUMANENSP00000338010STRING
IL21_HUMANENSP00000338010STRING
IL2RG_HUMANENSP00000338010STRING
IL15_HUMANENSP00000338010STRING
- top -

Disease Reference
Kegg disease
OMIM disease
615207IL21R immunodeficiency (IL21RID)
Drug Reference
Kegg drug
D09332 Denenicokin (USAN/INN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
C-linked Glycosylation
ReferencePubMed
"Crystal structure of interleukin-21 receptor (IL-21R) bound to IL-21reveals that sugar chain interacting with WSXWS motif is integral partof IL-21R.";
Hamming O.J., Kang L., Svensson A., Karlsen J.L., Rahbek-Nielsen H.,Paludan S.R., Hjorth S.A., Bondensgaard K., Hartmann R.;
J. Biol. Chem. 287:9454-9460(2012).
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 20-232 IN COMPLEX WITH IL21,WSXWS MOTIF, GLYCOSYLATION AT ASN-73 AND TRP-214, FIBRONECTIN DOMAINS,AND DISULFIDE BONDS.
N-linked Glycosylation
ReferencePubMed
"Crystal structure of interleukin-21 receptor (IL-21R) bound to IL-21reveals that sugar chain interacting with WSXWS motif is integral partof IL-21R.";
Hamming O.J., Kang L., Svensson A., Karlsen J.L., Rahbek-Nielsen H.,Paludan S.R., Hjorth S.A., Bondensgaard K., Hartmann R.;
J. Biol. Chem. 287:9454-9460(2012).
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 20-232 IN COMPLEX WITH IL21,WSXWS MOTIF, GLYCOSYLATION AT ASN-73 AND TRP-214, FIBRONECTIN DOMAINS,AND DISULFIDE BONDS.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures