Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Branched-chain-amino-acid aminotransferase  

UniProtKB / Swiss-Prot ID :  ILVE_MYCS2

Gene Name (Synonyms) : 
ilvE MSMEG_4276  

Species :  Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155). 

Subcellular Localization :   

Protein Function :  Catalyzes the reversible transfers of an amino group from glutamate to the alpha-ketoacid of the respective amino acid in the final step in the biosynthesis of branchedchain amino acids. The amino acids can be ranked in the following order with respect to their efficiency as amino donor: Leu > Ile > Val. 

Protein Sequence MNSGPLEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGWHNAQVIPYGPIQLDPSAIVL...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
204N6-(pyridoxal phosphate)lysine.TGAAKFGGN
43.97UniProtKB
Link
299Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-...)DEWQKKAGA
45.74PupDB
Link
299Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup).DEWQKKAGA
45.74UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures