Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Insulin  

UniProtKB / Swiss-Prot ID :  INS_HUMAN

Gene Name (Synonyms) : 
INS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. 

Protein Sequence MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCC...
Protein Variant
LocationDescription
6R -> C (in MODY10; dbSNP:rs121908278). VAR_063721
6R -> H (in MODY10; dbSNP:rs121908259). VAR_063722
24A -> D (in PNDM; dbSNP:rs80356663). VAR_063723
29H -> D (in PNDM; dbSNP:rs121908272). VAR_063724
32G -> R (in PNDM; dbSNP:rs80356664). VAR_063725
32G -> S (in PNDM; dbSNP:rs80356664). VAR_063726
34H -> D (in FHPRI; Providence). VAR_003971
35L -> P (in PNDM; dbSNP:rs121908273). VAR_063727
43C -> G (in PNDM; dbSNP:rs80356666). VAR_063728
46R -> Q (in MODY10; dbSNP:rs121908260). VAR_063729
47G -> V (in PNDM; dbSNP:rs80356667). VAR_063730
48F -> C (in PNDM; dbSNP:rs80356668). VAR_063731
48F -> S (associated with diabetes mellitustype-II; Los-Angeles).
49F -> L (in Chicago). VAR_003973
55R -> C (in IDDM2; dbSNP:rs121908261). VAR_063732
68L -> M (in dbSNP:rs121908279). VAR_063733
84G -> R (in PNDM; uncertain pathologicalsignificance; dbSNP:rs121908274).
89R -> C (in PNDM; dbSNP:rs80356669). VAR_063735
89R -> H (in FHPRI; impairsposttranslational cleavage;
89R -> L (in FHPRI; Kyoto). VAR_003975
90G -> C (in PNDM; dbSNP:rs80356670). VAR_063736
92V -> L (in Wakayama). VAR_003976
96C -> S (in PNDM; dbSNP:rs80356671). VAR_063737
96C -> Y (in PNDM; dbSNP:rs80356671). VAR_063738
101S -> C (in PNDM; dbSNP:rs121908276). VAR_063739
103Y -> C (in PNDM; dbSNP:rs121908277). VAR_063740
108Y -> C (in PNDM; dbSNP:rs80356672). VAR_063741
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25nonePAAAFVNQH
CHHHCCCCC
4.55HPRD
Link-
25nonePAAAFVNQH
CHHHCCCCC
4.55HPRD
Link-
28noneAFVNQHLCG
HCCCCCCCH
26.15HPRD
Link-
33noneHLCGSHLVE
CCCHHHHHH
16.80HPRD
Link-
35noneCGSHLVEAL
CHHHHHHHH
3.89HPRD
Link-
37noneSHLVEALYL
HHHHHHHHH
39.04HPRD
Link-
37noneSHLVEALYL
HHHHHHHHH
39.04HPRD
Link-
38noneHLVEALYLV
HHHHHHHHH
8.27HPRD
Link-
39noneLVEALYLVC
HHHHHHHHH
1.84HPRD
Link-
40noneVEALYLVCG
HHHHHHHHC
12.25HPRD
Link-
40noneVEALYLVCG
HHHHHHHHC
12.25HPRD
Link-
41noneEALYLVCGE
HHHHHHHCC
2.40HPRD
Link-
45noneLVCGERGFF
HHHCCCCCC
44.49HPRD
Link-
47noneCGERGFFYT
HCCCCCCCC
16.83HPRD
Link-
48noneGERGFFYTP
CCCCCCCCC
5.46HPRD
Link-
48noneGERGFFYTP
CCCCCCCCC
5.46HPRD
Link-
49noneERGFFYTPK
CCCCCCCCC
8.06HPRD
Link-
55noneTPKTRREAE
CCCCCHHHH
40.34HPRD
Link-
89noneSLQKRGIVE
HHCCCCCEE
27.40HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
INS_HUMANdirect interaction
direct interaction
DIP:57415EDIP17472440
17472440
INSR_HUMANin vivoHPRD:01455HPRD2550426
IGF1R_HUMANin vivoHPRD:01455HPRD1851182
INS_HUMANin vivoHPRD:01455HPRD12021212
NOV_HUMANin vitroHPRD:01455HPRD10084601
RB_HUMANin vitro
in vivo
HPRD:01455HPRD10938588
7818556
MPRD_HUMANENSP00000250971STRING
MPRD_HUMANENSP00000250971STRING
CP51A_HUMANENSP00000250971STRING
CP51A_HUMANENSP00000250971STRING
CBPB2_HUMANENSP00000250971STRING
CBPB2_HUMANENSP00000250971STRING
CETP_HUMANENSP00000250971STRING
CETP_HUMANENSP00000250971STRING
PPCKM_HUMANENSP00000250971STRING
PPCKM_HUMANENSP00000250971STRING
RETN_HUMANENSP00000250971STRING
RETN_HUMANENSP00000250971STRING
CD79A_HUMANENSP00000250971STRING
CD79A_HUMANENSP00000250971STRING
CD79A_HUMANENSP00000250971STRING
CD79A_HUMANENSP00000250971STRING
PAI1_HUMANENSP00000250971STRING
PAI1_HUMANENSP00000250971STRING
REL1_HUMANENSP00000250971STRING
REL1_HUMANENSP00000250971STRING
KS6B1_HUMANENSP00000250971STRING
KS6B1_HUMANENSP00000250971STRING
ISL1_HUMANENSP00000250971STRING
ISL1_HUMANENSP00000250971STRING
GHR_HUMANENSP00000250971STRING
GHR_HUMANENSP00000250971STRING
LCAP_HUMANENSP00000250971STRING
LCAP_HUMANENSP00000250971STRING
APOB_HUMANENSP00000250971STRING
APOB_HUMANENSP00000250971STRING
DOK1_HUMANENSP00000250971STRING
DOK1_HUMANENSP00000250971STRING
IBP2_HUMANENSP00000250971STRING
IBP2_HUMANENSP00000250971STRING
PLEK_HUMANENSP00000250971STRING
PLEK_HUMANENSP00000250971STRING
CREB1_HUMANENSP00000250971STRING
CREB1_HUMANENSP00000250971STRING
SLIB_HUMANENSP00000250971STRING
SLIB_HUMANENSP00000250971STRING
DUS1_HUMANENSP00000250971STRING
DUS1_HUMANENSP00000250971STRING
EGR1_HUMANENSP00000250971STRING
EGR1_HUMANENSP00000250971STRING
IAPP_HUMANENSP00000250971STRING
IAPP_HUMANENSP00000250971STRING
MYOG_HUMANENSP00000250971STRING
MYOG_HUMANENSP00000250971STRING
NPY_HUMANENSP00000250971STRING
NPY_HUMANENSP00000250971STRING
NGN3_HUMANENSP00000250971STRING
NGN3_HUMANENSP00000250971STRING
ELAF_HUMANENSP00000250971STRING
ELAF_HUMANENSP00000250971STRING
LIPS_HUMANENSP00000250971STRING
LIPS_HUMANENSP00000250971STRING
ALR_HUMANENSP00000250971STRING
ALR_HUMANENSP00000250971STRING
MYOD1_HUMANENSP00000250971STRING
MYOD1_HUMANENSP00000250971STRING
TXD17_HUMANENSP00000250971STRING
TXD17_HUMANENSP00000250971STRING
LDLR_HUMANENSP00000250971STRING
LDLR_HUMANENSP00000250971STRING
APOE_HUMANENSP00000250971STRING
APOE_HUMANENSP00000250971STRING
CP2E1_HUMANENSP00000250971STRING
CP2E1_HUMANENSP00000250971STRING
G6PT_HUMANENSP00000250971STRING
G6PT_HUMANENSP00000250971STRING
FABP4_HUMANENSP00000250971STRING
FABP4_HUMANENSP00000250971STRING
HNF1A_HUMANENSP00000250971STRING
HNF1A_HUMANENSP00000250971STRING
IL6_HUMANENSP00000250971STRING
IL6_HUMANENSP00000250971STRING
DCE2_HUMANENSP00000250971STRING
DCE2_HUMANENSP00000250971STRING
NOV_HUMANENSP00000250971STRING
NOV_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
SRBP1_HUMANENSP00000250971STRING
PPARA_HUMANENSP00000250971STRING
PPARA_HUMANENSP00000250971STRING
UCP1_HUMANENSP00000250971STRING
UCP1_HUMANENSP00000250971STRING
MK03_HUMANENSP00000250971STRING
MK03_HUMANENSP00000250971STRING
GRB14_HUMANENSP00000250971STRING
GRB14_HUMANENSP00000250971STRING
ATF2_HUMANENSP00000250971STRING
ATF2_HUMANENSP00000250971STRING
FGF2_HUMANENSP00000250971STRING
FGF2_HUMANENSP00000250971STRING
STAT3_HUMANENSP00000250971STRING
STAT3_HUMANENSP00000250971STRING
COLI_HUMANENSP00000250971STRING
COLI_HUMANENSP00000250971STRING
ICAM1_HUMANENSP00000250971STRING
ICAM1_HUMANENSP00000250971STRING
PRGC1_HUMANENSP00000250971STRING
PRGC1_HUMANENSP00000250971STRING
TRFE_HUMANENSP00000250971STRING
TRFE_HUMANENSP00000250971STRING
EGF_HUMANENSP00000250971STRING
EGF_HUMANENSP00000250971STRING
IDE_HUMANENSP00000250971STRING
IDE_HUMANENSP00000250971STRING
IGF1R_HUMANENSP00000250971STRING
IGF1R_HUMANENSP00000250971STRING
P53_HUMANENSP00000250971STRING
P53_HUMANENSP00000250971STRING
ERBB2_HUMANENSP00000250971STRING
ERBB2_HUMANENSP00000250971STRING
IBP4_HUMANENSP00000250971STRING
IBP4_HUMANENSP00000250971STRING
AKT1_HUMANENSP00000250971STRING
AKT1_HUMANENSP00000250971STRING
CALM_HUMANENSP00000250971STRING
CALM_HUMANENSP00000250971STRING
P85A_HUMANENSP00000250971STRING
P85A_HUMANENSP00000250971STRING
EGFR_HUMANENSP00000250971STRING
EGFR_HUMANENSP00000250971STRING
IBP3_HUMANENSP00000250971STRING
IBP3_HUMANENSP00000250971STRING
IBP1_HUMANENSP00000250971STRING
IBP1_HUMANENSP00000250971STRING
SYTL4_HUMANENSP00000250971STRING
SYTL4_HUMANENSP00000250971STRING
GON1_HUMANENSP00000250971STRING
GON1_HUMANENSP00000250971STRING
IF4E_HUMANENSP00000250971STRING
IF4E_HUMANENSP00000250971STRING
PTHY_HUMANENSP00000250971STRING
PTHY_HUMANENSP00000250971STRING
PDE3B_HUMANENSP00000250971STRING
PDE3B_HUMANENSP00000250971STRING
FBX32_HUMANENSP00000250971STRING
FBX32_HUMANENSP00000250971STRING
SMS_HUMANENSP00000250971STRING
SMS_HUMANENSP00000250971STRING
PPARG_HUMANENSP00000250971STRING
PPARG_HUMANENSP00000250971STRING
HXK2_HUMANENSP00000250971STRING
HXK2_HUMANENSP00000250971STRING
AGRP_HUMANENSP00000250971STRING
AGRP_HUMANENSP00000250971STRING
CCL16_HUMANENSP00000250971STRING
CCL16_HUMANENSP00000250971STRING
LMX1A_HUMANENSP00000250971STRING
LMX1A_HUMANENSP00000250971STRING
NDF1_HUMANENSP00000250971STRING
NDF1_HUMANENSP00000250971STRING
IBP7_HUMANENSP00000250971STRING
IBP7_HUMANENSP00000250971STRING
PTPRN_HUMANENSP00000250971STRING
PTPRN_HUMANENSP00000250971STRING
ALBU_HUMANENSP00000250971STRING
ALBU_HUMANENSP00000250971STRING
ALBU_HUMANENSP00000250971STRING
ALBU_HUMANENSP00000250971STRING
SHH_HUMANENSP00000250971STRING
SHH_HUMANENSP00000250971STRING
NOS3_HUMANENSP00000250971STRING
NOS3_HUMANENSP00000250971STRING
EHMT1_HUMANENSP00000250971STRING
EHMT1_HUMANENSP00000250971STRING
PRL_HUMANENSP00000250971STRING
PRL_HUMANENSP00000250971STRING
HSP74_HUMANENSP00000250971STRING
HSP74_HUMANENSP00000250971STRING
INSR_HUMANENSP00000250971STRING
INSR_HUMANENSP00000250971STRING
FAS_HUMANENSP00000250971STRING
FAS_HUMANENSP00000250971STRING
IRS1_HUMANENSP00000250971STRING
IRS1_HUMANENSP00000250971STRING
CEBPB_HUMANENSP00000250971STRING
CEBPB_HUMANENSP00000250971STRING
FOS_HUMANENSP00000250971STRING
FOS_HUMANENSP00000250971STRING
LIPL_HUMANENSP00000250971STRING
LIPL_HUMANENSP00000250971STRING
RASH_HUMANENSP00000250971STRING
RASH_HUMANENSP00000250971STRING
FOSL1_HUMANENSP00000250971STRING
FOSL1_HUMANENSP00000250971STRING
GRB7_HUMANENSP00000250971STRING
GRB7_HUMANENSP00000250971STRING
UCP2_HUMANENSP00000250971STRING
UCP2_HUMANENSP00000250971STRING
LEP_HUMANENSP00000250971STRING
LEP_HUMANENSP00000250971STRING
SOMA_HUMANENSP00000250971STRING
SOMA_HUMANENSP00000250971STRING
EDNRA_HUMANENSP00000250971STRING
EDNRA_HUMANENSP00000250971STRING
VEGFA_HUMANENSP00000250971STRING
VEGFA_HUMANENSP00000250971STRING
GYS1_HUMANENSP00000250971STRING
GYS1_HUMANENSP00000250971STRING
ADIPO_HUMANENSP00000250971STRING
ADIPO_HUMANENSP00000250971STRING
GTR4_HUMANENSP00000250971STRING
GTR4_HUMANENSP00000250971STRING
GTR2_HUMANENSP00000250971STRING
GTR2_HUMANENSP00000250971STRING
UCP3_HUMANENSP00000250971STRING
UCP3_HUMANENSP00000250971STRING
FOXC2_HUMANENSP00000250971STRING
FOXC2_HUMANENSP00000250971STRING
MAFA_HUMANENSP00000250971STRING
MAFA_HUMANENSP00000250971STRING
SP1_HUMANENSP00000250971STRING
SP1_HUMANENSP00000250971STRING
SOCS3_HUMANENSP00000250971STRING
SOCS3_HUMANENSP00000250971STRING
LEPR_HUMANENSP00000250971STRING
LEPR_HUMANENSP00000250971STRING
WT1_HUMANENSP00000250971STRING
WT1_HUMANENSP00000250971STRING
ACTG_HUMANENSP00000250971STRING
ACTG_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
CFAD_HUMANENSP00000250971STRING
GHRL_HUMANENSP00000250971STRING
GHRL_HUMANENSP00000250971STRING
HIF1A_HUMANENSP00000250971STRING
HIF1A_HUMANENSP00000250971STRING
HIF1A_HUMANENSP00000250971STRING
HIF1A_HUMANENSP00000250971STRING
FGF1_HUMANENSP00000250971STRING
FGF1_HUMANENSP00000250971STRING
SOCS2_HUMANENSP00000250971STRING
SOCS2_HUMANENSP00000250971STRING
FOXO3_HUMANENSP00000250971STRING
FOXO3_HUMANENSP00000250971STRING
4EBP1_HUMANENSP00000250971STRING
4EBP1_HUMANENSP00000250971STRING
FAK1_HUMANENSP00000250971STRING
FAK1_HUMANENSP00000250971STRING
STA5A_HUMANENSP00000250971STRING
STA5A_HUMANENSP00000250971STRING
ADR1_HUMANENSP00000250971STRING
ADR1_HUMANENSP00000250971STRING
PTTG1_HUMANENSP00000250971STRING
PTTG1_HUMANENSP00000250971STRING
PTTG2_HUMANENSP00000250971STRING
PTTG2_HUMANENSP00000250971STRING
TNR6_HUMANENSP00000250971STRING
TNR6_HUMANENSP00000250971STRING
ATTY_HUMANENSP00000250971STRING
ATTY_HUMANENSP00000250971STRING
MPRI_HUMANENSP00000250971STRING
MPRI_HUMANENSP00000250971STRING
ACTB_HUMANENSP00000250971STRING
ACTB_HUMANENSP00000250971STRING
GIP_HUMANENSP00000250971STRING
GIP_HUMANENSP00000250971STRING
MK08_HUMANENSP00000250971STRING
MK08_HUMANENSP00000250971STRING
APOC3_HUMANENSP00000250971STRING
APOC3_HUMANENSP00000250971STRING
DPP4_HUMANENSP00000250971STRING
DPP4_HUMANENSP00000250971STRING
- top -

Disease Reference
Kegg disease
OMIM disease
616214Hyperproinsulinemia (HPRI)
125852Diabetes mellitus, insulin-dependent, 2 (IDDM2)
606176Diabetes mellitus, permanent neonatal (PNDM)
613370Maturity-onset diabetes of the young 10 (MODY10)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures