Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Isovaleryl-CoA dehydrogenase, mitochondrial  

UniProtKB / Swiss-Prot ID :  IVD_HUMAN

Gene Name (Synonyms) : 
IVD  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion matrix. 

Protein Function :   

Protein Sequence MATATRLLGWRVASWRLRPPLAGFVSQRAHSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDR...
Predicted Secondary Structure CCHHHHHHHHCHHCCCCCCCHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
42L -> P (in IVA). VAR_000423
50R -> P (in IVA). VAR_015960
69D -> N (in IVA). VAR_015961
199G -> V (in IVA). VAR_000424
311A -> V (in IVA). VAR_015962
357C -> R (in IVA). VAR_015963
371V -> A (in IVA). VAR_015964
392R -> C (in IVA). VAR_015965
411R -> L (in IVA). VAR_015966
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
55Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QTMAKFLQE
HHHHHHHHH
35.47Phosphositeplus
Link
75N6-acetyllysineSNEFKNLRE
HCCCCCHHH
49.22Phosphositeplus
Link
75N6-acetyllysine.SNEFKNLRE
HCCCCCHHH
49.22UniProtKB
Link
155PhosphoserinePKLISGEYI
HHHHCCCCE
35.69Phosphositeplus
Link
158PhosphotyrosineISGEYIGAL
HCCCCEEEE
14.26Phosphositeplus
Link
211PhosphothreonineVYAKTDLAA
EEEEEECCC
28.24Phosphositeplus
Link
219PhosphoserineAVPASRGIT
CCCCCCCEE
25.60Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
IVD_HUMANin vitroHPRD:09516HPRD6401713
10713113
ADPN_HUMANENSP00000249760STRING
ECHP_HUMANENSP00000249760STRING
MCCA_HUMANENSP00000249760STRING
MYST3_HUMANENSP00000249760STRING
ESCO1_HUMANENSP00000249760STRING
MYST4_HUMANENSP00000249760STRING
ESCO2_HUMANENSP00000249760STRING
NAT5_HUMANENSP00000249760STRING
MCCC2_HUMANENSP00000249760STRING
- top -

Disease Reference
Kegg disease
OMIM disease
243500Isovaleric acidemia (IVA)
Drug Reference
DrugBank
DB03147Flavin adenine dinucleotide
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-75, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures