Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Keratin, type II cytoskeletal 6C  

UniProtKB / Swiss-Prot ID :  K2C6C_HUMAN

Gene Name (Synonyms) : 
KRT6C, KRT6E  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI...
Predicted Secondary Structure CCCEEEEEECCCCCCCCCCCCCEECCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCEE...
Protein Variant
LocationDescription
182R -> Q (in dbSNP:rs11608915). VAR_035031
227S -> N (in dbSNP:rs17099602). VAR_035032
481V -> I (in dbSNP:rs412533). VAR_035033
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASTST
---CCCEEE
22.86UniProtKB
Link-
60PhosphoserineFGSRSLYGL
CCCCCEEEC
27.86HPRD
Link-
60PhosphoserineFGSRSLYGL
CCCCCEEEC
27.86PhosphoELM
Link-
60Phosphoserine.FGSRSLYGL
CCCCCEEEC
27.86UniProtKB
Link-
62PhosphotyrosineSRSLYGLGG
CCCEEECCC
16.14Phosphositeplus
Link-
71PhosphoserineSKRISIGGG
CCEEEEECC
21.15HPRD
Link-
76PhosphoserineIGGGSCAIS
EECCCCCCC
12.03HPRD
Link-
83PhosphotyrosineISGGYGSRA
CCCCCCCCC
18.56HPRD
Link-
83PhosphotyrosineISGGYGSRA
CCCCCCCCC
18.56Phosphositeplus
Link-
168Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)REQIKTLNN
HHHHHHHHH
46.80Phosphositeplus
Link-
173Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLNNKFASF
HHHHHHHHH
41.03Phosphositeplus
Link-
180Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SFIDKVRFL
HHHHHHHHH
30.41Phosphositeplus
Link-
180N6-acetyllysineSFIDKVRFL
HHHHHHHHH
30.41Phosphositeplus
Link-
278PhosphotyrosineVDAAYMNKV
HHHHHHHHH
11.71Phosphositeplus
Link-
341PhosphotyrosineVKAQYEEIA
HHHHHHHHH
22.01PhosphoELM
Link-
341PhosphotyrosineVKAQYEEIA
HHHHHHHHH
22.01Phosphositeplus
Link-
341Phosphotyrosine.VKAQYEEIA
HHHHHHHHH
22.01UniProtKB
Link-
356PhosphotyrosineAESWYQTKY
HHHHHHHHH
18.65Phosphositeplus
Link-
360PhosphotyrosineYQTKYEELQ
HHHHHHHHH
20.30Phosphositeplus
Link-
551PhosphotyrosineSTIKYTTTS
EEEEEEECC
12.88Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
OMIM disease
615735Palmoplantar keratoderma, non-epidermolytic, focal or diffuse (PPKNEFD)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphorylation of human keratin 8 in vivo at conserved head domainserine 23 and at epidermal growth factor-stimulated tail domain serine431.";
Ku N.-O., Omary M.B.;
J. Biol. Chem. 272:7556-7564(1997).
Cited for: PHOSPHORYLATION AT SER-60.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-341, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures