Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  6-phosphofructokinase, liver type  

UniProtKB / Swiss-Prot ID :  K6PL_MOUSE

Gene Name (Synonyms) : 
Pfkl, Pfk-l, Pfkb  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKPANW...
Predicted Secondary Structure CCCCHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCCCEECCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
351S-nitrosocysteinePLMECVQVT
CHHHHHHCC
1.29dbSNO
Link-
377PhosphoserineLRGRSFENN
HCCCHHHHH
39.47Phosphositeplus
Link-
640PhosphotyrosineTEFLYNLYS
HHHHHHHHH
14.40Phosphositeplus
Link-
640PhosphotyrosineTEFLYNLYS
HHHHHHHHH
14.40SysPTM
Link-
640Phosphotyrosine.TEFLYNLYS
HHHHHHHHH
14.40UniProtKB
Link-
708S-nitrosocysteinePDSACVIGL
CCCEEEEEE
2.37dbSNO
Link-
773PhosphothreonineVTRRTLSID
EEEEEEECC
22.90Phosphositeplus
Link-
775PhosphoserineRRTLSIDKG
EEEEECCCC
28.29Phosphositeplus
Link-
775PhosphoserineRRTLSIDKG
EEEEECCCC
28.29SysPTM
Link-
775Phosphoserine.RRTLSIDKG
EEEEECCCC
28.29UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-640, AND MASSSPECTROMETRY.
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-775, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures