Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Arginine kinase  

UniProtKB / Swiss-Prot ID :  KARG_HOMGA

Gene Name (Synonyms) :  -
 

Species :  Homarus gammarus (European lobster) (Homarus vulgaris). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MADAATIAKLEEGFKKLEAATDCKSLLKKYLSKDIFDSLKAKKTSLGATLLDVIQSGVENLDSGVGIYAP...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHCCCCCHHHHHHCCCHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCEEEEEEC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADAAT
---CCCHHH
18.36UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Primary structure of lobster-muscle arginine kinase. Amino andcarboxyl-terminal structure of the enzyme and complete alignment ofthe cyanogen-bromide peptides.";
Regnouf F., Kassab R., Debuire B., Richard C., Han K.K.;
Int. J. Pept. Protein Res. 17:143-155(1981).
Cited for: PRELIMINARY PARTIAL PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures