Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kynurenine--oxoglutarate transaminase 1  

UniProtKB / Swiss-Prot ID :  KAT1_HUMAN

Gene Name (Synonyms) : 
CCBL1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the irreversible transamination of the L- tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta- elimination of S-conjugates and Se-conjugates of L- (seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. 

Protein Sequence MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCHHHHCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
172PhosphothreonineAGKFTSRTK
HHHCCCCCC
22.30HPRD
Link
172PhosphothreonineAGKFTSRTK
HHHCCCCCC
22.30Phosphositeplus
Link
175PhosphothreonineFTSRTKALV
CCCCCCEEE
22.04HPRD
Link
182PhosphothreonineLVLNTPNNP
EEEECCCCC
24.19HPRD
Link
182PhosphothreonineLVLNTPNNP
EEEECCCCC
24.19Phosphositeplus
Link
247N6-(pyridoxal phosphate)lysine.GSAGKTFSA
ECCHHHCCC
46.22UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
KAT1_HUMANin vitroHPRD:02769HPRD7814371
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00130L-Glutamine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures