Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kynurenine--oxoglutarate transaminase 3  

UniProtKB / Swiss-Prot ID :  KAT3_MOUSE

Gene Name (Synonyms) : 
Ccbl2, Kat3  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  Catalyzes the irreversible transamination of the L- tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se- conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2- oxoglutarate as amino group acceptor (in vitro). 

Protein Sequence MLLAQRRLISLGCRSKPIKTIYSSSKVLGLCTSAKMALKFKNAKRIEGLDSNVWVEFTKLAADPSVVNLG...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHCCCCCEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
109N6-acetyllysinePALVKALSC
HHHHHHHHH
44.45Phosphositeplus
Link
281N6-(pyridoxal phosphate)lysine.GSAGKTFSV
ECCHHHCCC
46.22UniProtKB
Link
338S-nitrosocysteineDDPECYFNS
HHHHHHHHH
5.98dbSNO
Link
417S-nitrosocysteineVSAFCDSKS
CCCCCCCCC
6.05dbSNO
Link
432S-nitrosocysteineLVRFCFIKK
EEEEEEECC
2.12dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures