Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Casein kinase I isoform alpha  

UniProtKB / Swiss-Prot ID :  KC1A_MOUSE

Gene Name (Synonyms) : 
Csnk1a1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). Cytoplasm, cytoskeleton, centrosome (By similarity). Chromosome, centromere, kinetochore (By similarity). Nucleus speckle (By similarity). Note=Localizes to the centrosome in interphase cells, and to kinetochore fibers during m 

Protein Function :  Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May play a role in segregating chromosomes during mitosis (By similarity). 

Protein Sequence MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGG...
Predicted Secondary Structure CCCCCCCCCCEEECCCEEEEEEEECCCCEEEEEEEECCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
294PhosphotyrosineHQYDYTFDW
CCCCCCCCC
12.36Phosphositeplus
Link-
294PhosphotyrosineHQYDYTFDW
CCCCCCCCC
12.36SysPTM
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures