Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  BTB/POZ domain-containing protein KCTD5  

UniProtKB / Swiss-Prot ID :  KCTD5_HUMAN

Gene Name (Synonyms) : 
KCTD5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytosol. Nucleus. Note=Predominantly cytoplasmic, translocated to the nucleus upon interaction with Rep proteins. 

Protein Function :  Its interaction with CUL3 suggests that it may act as a substrate adapter in some E3 ligase complex. Does not affect the function of Kv channel Kv2.1/KCNB1, Kv1.2/KCNA2, Kv4.2/KCND2 and Kv3.4/KCNC4. 

Protein Sequence MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFL...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHCCCCCCCCEEEEEECCEEEEEEHHHHHHCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAENHC
---CCCCCC
26.71UniProtKB
Link-
10PhosphoserineCELLSPARG
CCCCCCCCC
29.19HPRD
Link-
10PhosphoserineCELLSPARG
CCCCCCCCC
29.19Phosphositeplus
Link-
10Phosphoserine.CELLSPARG
CCCCCCCCC
29.19UniProtKB
Link-
29PhosphoserineCRRCSAGLG
CCCCCCCCC
24.45Phosphositeplus
Link-
147PhosphoserineRERDSKTSQ
HHHCCCCCC
44.01HPRD
Link
147PhosphoserineRERDSKTSQ
HHHCCCCCC
44.01Phosphositeplus
Link
147PhosphoserineRERDSKTSQ
HHHCCCCCC
44.01SysPTM
Link
148Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ERDSKTSQV
HHCCCCCCC
57.39Phosphositeplus
Link
223Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EPSEKAKIL
CCCHHHHHH
60.35Phosphositeplus
Link-
225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SEKAKILQE
CHHHHHHHH
55.83Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
KCTD5_HUMANin vivoHPRD:13768HPRD16501559
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-10, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-10, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures