Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Guanylate kinase  

UniProtKB / Swiss-Prot ID :  KGUA_MOUSE

Gene Name (Synonyms) : 
Guk1, Gmk  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  Essential for recycling GMP and indirectly, cGMP. 

Protein Sequence MAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDF...
Predicted Secondary Structure CCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCEEECCHHHHHHHHHCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
37PhosphoserineGFSVSHTTR
EEEEEEECC
17.58Phosphositeplus
Link
53PhosphotyrosineDGKDYYFVT
CCCCEEECC
11.42Phosphositeplus
Link
53Phosphotyrosine.DGKDYYFVT
CCCCEEECC
11.42UniProtKB
Link
54PhosphotyrosineGKDYYFVTR
CCCEEECCH
11.16Phosphositeplus
Link
57PhosphothreonineYYFVTREMM
EEECCHHHH
15.83Phosphositeplus
Link
98S-nitrosocysteineMNRICVLDV
CCCCEEEEE
1.94dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-53, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures