Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kinesin-like protein KIF1A  

UniProtKB / Swiss-Prot ID :  KIF1A_MOUSE

Gene Name (Synonyms) : 
Kif1a, Atsv, Kif1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, cytoskeleton (By similarity). Note=Expressed in distal regions of neurites (By similarity). 

Protein Function :  Motor for anterograde axonal transport of synaptic vesicle precursors. 

Protein Sequence MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQ...
Predicted Secondary Structure CCCCCEEEEEEECCCCHHHHHCCCCEEEEECCCEEEEECCCCCCCCCCEEEEEEEECCCCCCCCCCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
31PhosphoserineIIQMSGSTT
EEEECCCEE
17.14Phosphositeplus
Link
33PhosphoserineQMSGSTTTI
EECCCEEEE
18.44Phosphositeplus
Link
36PhosphothreonineGSTTTIVNP
CCEEEEECC
24.02Phosphositeplus
Link
266N6-acetyllysineGTRLKEGAN
HHHHHHHHH
51.30Phosphositeplus
Link
280N6-acetyllysineTTLGKVISA
HHHHHHHHH
39.24Phosphositeplus
Link
294N6-acetyllysineSGPNKNKKK
CCCCCCCCC
73.59Phosphositeplus
Link-
419PhosphoserineASVSSLHER
CCHHHHHHH
31.43Phosphositeplus
Link-
487PhosphoserineLGVFSPKKT
EECCCCCCC
33.14Phosphositeplus
Link-
607PhosphothreonineERERTPCAE
HHHCCCCCC
20.26Phosphositeplus
Link-
612PhosphothreoninePCAETPAEP
CCCCCCCCC
14.85Phosphositeplus
Link-
912PhosphoserineTAKISFDDQ
EEEEECCHH
23.16Phosphositeplus
Link-
932PhosphoserineVVGMSRSGT
EEEEECCCC
19.84Phosphositeplus
Link-
936PhosphothreonineSRSGTSQEE
ECCCCCHHH
28.60Phosphositeplus
Link-
937PhosphoserineRSGTSQEEL
CCCCCHHHH
38.84Phosphositeplus
Link-
1093PhosphoserineKDVLSPLRP
HHHCCCCCC
23.03Phosphositeplus
Link-
1315PhosphoserineNLFGSGSLR
HHHHCCEEC
20.20Phosphositeplus
Link-
1342PhosphoserineADAGSPGMQ
CCCCCCHHH
21.72Phosphositeplus
Link-
1373PhosphoserineWRPRSDSLI
CCCCCCCCH
33.94Phosphositeplus
Link-
1375PhosphoserinePRSDSLILD
CCCCCCHHH
20.68Phosphositeplus
Link-
1498PhosphoserineMRDPSMSPL
CCCCCCCCC
35.86Phosphositeplus
Link-
1524PhosphothreonineRYGATDVRT
CCCCCCCCC
30.57Phosphositeplus
Link-
1528PhosphothreonineTDVRTPQPC
CCCCCCCCC
26.56Phosphositeplus
Link-
1533PhosphoserinePQPCSRPAS
CCCCCCCCC
48.24Phosphositeplus
Link-
1537PhosphoserineSRPASPEPE
CCCCCCCCC
32.26Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures