Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kinesin heavy chain isoform 5A  

UniProtKB / Swiss-Prot ID :  KIF5A_HUMAN

Gene Name (Synonyms) : 
KIF5A, NKHC1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, perinuclear region (By similarity). Cytoplasm, cytoskeleton (By similarity). Note=Concentrated in the cell body of the neurons, particularly in the perinuclear region (By similarity). 

Protein Function :  Microtubule-dependent motor required for slow axonal transport of neurofilament proteins (NFH, NFM and NFL) (By similarity). 

Protein Sequence MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQI...
Predicted Secondary Structure CCCCCCCCCEEEEEEECCCCHHHHHCCCCEEEEECCCCEEEECCEEEEEEEECCCCCCHHHHHHHHHHHH...
Protein Variant
LocationDescription
63Y -> C (in SPG10; complicated form). VAR_058741
198M -> T (in SPG10; complicated form). VAR_058742
203S -> C (in SPG10). VAR_066616
204R -> Q (in SPG10; complicated form). VAR_058743
251E -> K (in SPG10; complicated form). VAR_058744
253K -> N (in SPG10; decreases microtubuleaffinity; reduces gliding velocity;
256N -> S (in SPG10; slightly decreasesmicrotubule affinity; reduces gliding
256Missing (in SPG10). VAR_058745
257K -> N (in SPG10; complicated form). VAR_058746
276Y -> C (in SPG10). VAR_033108
280R -> C (in SPG10). VAR_032843
280R -> H (in SPG10; complicated form). VAR_058747
280R -> L (in SPG10; pure form). VAR_058748
361A -> V (in SPG10; does not affectmicrotubule affinity; does not affect
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAETNN
---CCCCCC
43.56UniProtKB
Link
705PhosphoserineLQMESHREA
HHHHHHHHH
23.62Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ASPP2_HUMANphysical interactionMINT-64142MINT16169070
MIPT3_HUMANphysical interactionEBI-1105986
intact17043677
KLC3_HUMANin vivoHPRD:09108HPRD10491391
NCOA2_HUMANin vivo
yeast 2-hybrid
HPRD:09108HPRD11986669
DTNB_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:09108HPRD14600269
ASPP2_HUMANyeast 2-hybridHPRD:09108HPRD16169070
KIF5A_HUMANin vivoHPRD:09108HPRD10964943
KINH_HUMANin vivoHPRD:09108HPRD10964943
KIF5C_HUMANin vivoHPRD:09108HPRD10964943
KINH_HUMANENSP00000286452STRING
KLC2_HUMANENSP00000286452STRING
KIF5C_HUMANENSP00000286452STRING
KLC3_HUMANENSP00000286452STRING
- top -

Disease Reference
Kegg disease
OMIM disease
604187Spastic paraplegia 10, autosomal dominant (SPG10)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures