Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kelch-like protein 8  

UniProtKB / Swiss-Prot ID :  KLHL8_HUMAN

Gene Name (Synonyms) : 
KLHL8, KIAA1378  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MASDSMSSKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAWKDFHGSLLRFYENGELCDVT...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCEEE...
Protein Variant
LocationDescription
520P -> R (in dbSNP:rs17854114). VAR_030012
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
28Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HQQIKNRSS
HHHCCCCCC
41.80Phosphositeplus
Link-
228Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IENEKQVYN
CCCHHHHHH
57.56Phosphositeplus
Link-
486Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PHLDKWIEV
CCCCEEEEC
57.33Phosphositeplus
Link-
491Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WIEVKEMGQ
EEECCCCCC
29.23Phosphositeplus
Link-
533Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PRSNKWDYV
CCCCEEEEC
42.56Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures