Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Keratin, high-sulfur matrix protein, B2C  

UniProtKB / Swiss-Prot ID :  KRB2C_SHEEP

Gene Name (Synonyms) :  -
 

Species :  Ovis aries (Sheep). 

Subcellular Localization :   

Protein Function :  The keratin products of mammalian epidermal derivatives such as wool and hair consist of microfibrils embedded in a rigid matrix of other proteins. The matrix proteins include the high- sulfur and high-tyrosine keratins, having molecular weights of 6- 20 kDa, whereas the microfibrils contain the larger, low-sulfur keratins (40-56 kDa). 

Protein Sequence MACCSTSFCGFPICSTAGTCGSSCCRSTCSQTSCCQPTSIQTSCCQPTCLQTSGCETGCGIGGSTGYGQV...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MACCST
---CCCCCC
11.74UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino-acid sequence of a high-sulphur protein from wool.";
Elleman T.C.;
Nature New Biol. 234:148-148(1971).
Cited for: PROTEIN SEQUENCE OF 2-152.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures