Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  KRR1 small subunit processome component homolog  

UniProtKB / Swiss-Prot ID :  KRR1_HUMAN

Gene Name (Synonyms) : 
KRR1, HRB2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus, nucleolus. Note=Translocates from cytoplasm to nucleus after exposure to HIV- 1 virus or HIV-1 protein VPR or induction by hydrocortisone and dexamethasone in the absence of HIV-1 protein VPR. 

Protein Function :  Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity). 

Protein Sequence MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREA...
Predicted Secondary Structure CCCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCC...
Protein Variant
LocationDescription
134R -> Q (in dbSNP:rs11540407). VAR_049680
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASPSL
---CCCCCC
30.10UniProtKB
Link-
3Phosphoserine--MASPSLE
--CCCCCCC
17.45HPRD
Link-
3Phosphoserine--MASPSLE
--CCCCCCC
17.45PhosphoELM
Link-
3Phosphoserine--MASPSLE
--CCCCCCC
17.45Phosphositeplus
Link-
3Phosphoserine--MASPSLE
--CCCCCCC
17.45SysPTM
Link-
3Phosphoserine.--MASPSLE
--CCCCCCC
17.45UniProtKB
Link-
5PhosphoserineMASPSLERP
CCCCCCCCC
40.13HPRD
Link-
5PhosphoserineMASPSLERP
CCCCCCCCC
40.13Phosphositeplus
Link-
5Phosphoserine.MASPSLERP
CCCCCCCCC
40.13UniProtKB
Link-
24Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NQKPKPENQ
CCCCCCCCH
72.50Phosphositeplus
Link-
38Caspase cleavage aspartic acidLTVPDGWKE
CCCCCCCCC
71.85Phosphositeplus
Link-
41Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PDGWKEPAF
CCCCCCCCC
60.39Phosphositeplus
Link-
106Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CTTKKTFDP
ECCCCCCCH
52.94Phosphositeplus
Link-
121Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RDLIKLLAR
HHHHHHHHH
44.75Phosphositeplus
Link-
168Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIGPKGSTL
HCCCCCCCH
61.35Phosphositeplus
Link-
220Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IYNIKSLMI
CHHHHHHHH
33.62Phosphositeplus
Link-
266PhosphotyrosineVKKEYTPFP
CEECCCCCC
28.70HPRD
Link-
266PhosphotyrosineVKKEYTPFP
CEECCCCCC
28.70Phosphositeplus
Link-
280Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SQIDKELAS
HHHHHHHHC
57.14Phosphositeplus
Link-
336PhosphoserinePKEASTETK
CCCCCCCCE
28.06Phosphositeplus
Link-
336Phosphoserine.PKEASTETK
CCCCCCCCE
28.06UniProtKB
Link-
337PhosphothreonineKEASTETKI
CCCCCCCEE
55.51Phosphositeplus
Link-
337Phosphothreonine.KEASTETKI
CCCCCCCEE
55.51UniProtKB
Link-
339PhosphothreonineASTETKIDV
CCCCCEEHH
33.13Phosphositeplus
Link-
339Phosphothreonine.ASTETKIDV
CCCCCEEHH
33.13UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-3 AND SER-5, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3 AND SER-5, AND MASSSPECTROMETRY.
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.";
Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.;
Anal. Sci. 24:161-166(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336; THR-337 ANDTHR-339, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-3 AND SER-5, AND MASS SPECTROMETRY.
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures