Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Kynureninase  

UniProtKB / Swiss-Prot ID :  KYNU_HUMAN

Gene Name (Synonyms) : 
KYNU  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3- hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3- hydroxyanthranilic acid (3-OHAA), respectively. Has a preference for the L-3-hydroxy form. Also has cysteine-conjugate-beta-lyase activity. 

Protein Sequence MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEE...
Protein Variant
LocationDescription
188R -> Q (in dbSNP:rs2304705). VAR_049724
198T -> A (detected in a boy withxanthurenic aciduria).
412K -> E (in dbSNP:rs9013). VAR_022092
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5PhosphoserineMEPSSLELP
CCCCCCCCC
36.26HPRD
Link
5PhosphoserineMEPSSLELP
CCCCCCCCC
36.26Phosphositeplus
Link
96Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DKWAKIAAY
HHHHHHHHC
31.59Phosphositeplus
Link
111PhosphothreonineRPWITGDES
CCCCCCCHH
34.41HPRD
Link
111PhosphothreonineRPWITGDES
CCCCCCCHH
34.41Phosphositeplus
Link
115PhosphoserineTGDESIVGL
CCCHHHHHH
27.58HPRD
Link
115PhosphoserineTGDESIVGL
CCCHHHHHH
27.58Phosphositeplus
Link
276N6-(pyridoxal phosphate)lysine.WCSYKYLNA
HHHHHHHHC
27.28UniProtKB
Link
297PhosphothreonineKHAHTIKPA
HHHHHCCHH
31.32HPRD
Link
365PhosphothreonineSVLLTGYLE
HHHHHHHHH
21.44HPRD
Link
460PhosphoserineSILDSAETK
HHHHHHHCC
25.26HPRD
Link-
460PhosphoserineSILDSAETK
HHHHHHHCC
25.26Phosphositeplus
Link-
463PhosphothreonineDSAETKN
HHHHCCC
35.29HPRD
Link-
463PhosphothreonineDSAETKN
HHHHCCC
35.29Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AADAT_HUMANENSP00000264170STRING
CATA_HUMANENSP00000264170STRING
T23O_HUMANENSP00000264170STRING
3HAO_HUMANENSP00000264170STRING
AFMID_HUMANENSP00000264170STRING
- top -

Disease Reference
Kegg disease
OMIM disease
236800Hydroxykynureninuria (HYXKY)
Drug Reference
DrugBank
DB00160L-Alanine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures