Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lantibiotic nisin-Z  

UniProtKB / Swiss-Prot ID :  LANZ_LACLL

Gene Name (Synonyms) : 
nisZ  

Species :  Lactococcus lactis subsp. lactis (Streptococcus lactis). 

Subcellular Localization :   

Protein Function :  Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. 

Protein Sequence MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
50N -> H (in strain: JCM 7638).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
252,3-didehydrobutyrine.SPRITSISL
22.68UniProtKB
Link
26Lanthionine (Ser-Cys).PRITSISLC
14.07UniProtKB
Link
282,3-didehydroalanine (Ser).ITSISLCTP
19.70UniProtKB
Link
31Beta-methyllanthionine (Thr-Cys).ISLCTPGCK
28.19UniProtKB
Link
36Beta-methyllanthionine (Thr-Cys).PGCKTGALM
31.59UniProtKB
Link
46Beta-methyllanthionine (Thr-Cys).CNMKTATCN
19.21UniProtKB
Link
48Beta-methyllanthionine (Thr-Cys).MKTATCNCS
14.96UniProtKB
Link
562,3-didehydroalanine (Ser).SIHVSK
20.63UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures