Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  La-related protein 6  

UniProtKB / Swiss-Prot ID :  LARP6_MOUSE

Gene Name (Synonyms) : 
Larp6  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Nucleus. Note=Shuttles between the nucleus and the cytoplasm (By similarity). 

Protein Function :  Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9 (By similarity). 

Protein Sequence MAQLGEQTLPGPETTVQIRVAIQEAEDLEDLEEEDEGTSARAAGDPARYLSPGWGSASEEEPSRGHSSAT...
Predicted Secondary Structure CCCCCCCCCCCCCCEEEEEEEEECCCCHHHHCHHHHCCHHCCCCCCHHHCCCCCCCHHHCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
56PhosphoserinePGWGSASEE
CCCCCHHHC
23.32Phosphositeplus
Link-
58PhosphoserineWGSASEEEP
CCCHHHCCC
47.43Phosphositeplus
Link-
409PhosphoserineNFSTSPEIF
CCCCCHHHH
21.24Phosphositeplus
Link-
443PhosphothreonineAEMGTQEKS
HHCCCCCCC
32.04Phosphositeplus
Link-
447PhosphoserineTQEKSPGAS
CCCCCCCCC
28.01Phosphositeplus
Link-
451PhosphoserineSPGASPLLS
CCCCCHHHH
23.23Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures