Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-lactate dehydrogenase A chain  

UniProtKB / Swiss-Prot ID :  LDHA_HUMAN

Gene Name (Synonyms) : 
LDHA PIG19  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL...
Predicted Secondary Structure CCCHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCC...
Protein Variant
LocationDescription
161S -> R (in dbSNP:rs5030621). VAR_059374
222K -> E. VAR_004180
315R -> C. VAR_004181
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATLKD
---CCCHHH
22.95UniProtKB
Link
5Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MATLKDQLI
CCCHHHHHH
38.79Phosphositeplus
Link
5N6-acetyllysineMATLKDQLI
CCCHHHHHH
38.79HPRD
Link
5N6-acetyllysineMATLKDQLI
CCCHHHHHH
38.79Phosphositeplus
Link
5N6-acetyllysine.MATLKDQLI
CCCHHHHHH
38.79UniProtKB
Link
10PhosphotyrosineDQLIYNLLK
HHHHHHHHC
14.35HPRD
Link
10PhosphotyrosineDQLIYNLLK
HHHHHHHHC
14.35Phosphositeplus
Link
10Phosphotyrosine.DQLIYNLLK
HHHHHHHHC
14.35UniProtKB
Link
14Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YNLLKEEQT
HHHHCCCCC
63.47Phosphositeplus
Link
14N6-acetyllysineYNLLKEEQT
HHHHCCCCC
63.47HPRD
Link
14N6-acetyllysineYNLLKEEQT
HHHHCCCCC
63.47Phosphositeplus
Link
14N6-acetyllysine.YNLLKEEQT
HHHHCCCCC
63.47UniProtKB
Link
57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VIEDKLKGE
CCCCCCHHH
39.03Phosphositeplus
Link
57N6-acetyllysineVIEDKLKGE
CCCCCCHHH
39.03HPRD
Link
57N6-acetyllysineVIEDKLKGE
CCCCCCHHH
39.03Phosphositeplus
Link
57N6-acetyllysine.VIEDKLKGE
CCCCCCHHH
39.03UniProtKB
Link
59Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDKLKGEMM
CCCCHHHHH
59.57Phosphositeplus
Link
76Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LRTPKIVSG
CCCCEEEEC
55.94Phosphositeplus
Link
81Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IVSGKDYNV
EEECCCHHH
49.92Phosphositeplus
Link
81N6-acetyllysineIVSGKDYNV
EEECCCHHH
49.92HPRD
Link
81N6-acetyllysineIVSGKDYNV
EEECCCHHH
49.92Phosphositeplus
Link
81N6-acetyllysine.IVSGKDYNV
EEECCCHHH
49.92UniProtKB
Link
83PhosphotyrosineSGKDYNVTA
ECCCHHHHC
18.28Phosphositeplus
Link
90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TANSKLVII
HCCCCEEEE
46.73Phosphositeplus
Link
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VNIFKFIIP
HHHHHHHHH
31.68Phosphositeplus
Link
118N6-acetyllysineVNIFKFIIP
HHHHHHHHH
31.68HPRD
Link
118N6-acetyllysineVNIFKFIIP
HHHHHHHHH
31.68Phosphositeplus
Link
118N6-acetyllysine.VNIFKFIIP
HHHHHHHHH
31.68UniProtKB
Link
126Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PNVVKYSPN
HHHHHHCCC
35.41Phosphositeplus
Link
126N6-acetyllysinePNVVKYSPN
HHHHHHCCC
35.41HPRD
Link
126N6-acetyllysinePNVVKYSPN
HHHHHHCCC
35.41Phosphositeplus
Link
126N6-acetyllysine.PNVVKYSPN
HHHHHHCCC
35.41UniProtKB
Link
132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPNCKLLIV
CCCEEEEEE
53.63Phosphositeplus
Link
155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SGFPKNRVI
CCCCHHHEE
55.94Phosphositeplus
Link
172PhosphotyrosineARFRYLMGE
HHHHHHHHH
9.79Phosphositeplus
Link
222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGTDKDKEQ
CCCCCCHHH
71.22Phosphositeplus
Link
222N6-acetyllysineLGTDKDKEQ
CCCCCCHHH
71.22HPRD
Link
222N6-acetyllysineLGTDKDKEQ
CCCCCCHHH
71.22Phosphositeplus
Link
222N6-acetyllysine.LGTDKDKEQ
CCCCCCHHH
71.22UniProtKB
Link
232Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEVHKQVVE
HHHHHHHHH
50.38Phosphositeplus
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73HPRD
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73PhosphoELM
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73Phosphositeplus
Link
239Phosphotyrosine.VESAYEVIK
HHHHHHHHH
21.73UniProtKB
Link
243Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YEVIKLKGY
HHHHHHHCC
49.69Phosphositeplus
Link
248PhosphothreonineLKGYTSWAI
HHCCCHHHH
26.85Phosphositeplus
Link
249PhosphoserineKGYTSWAIG
HCCCHHHHH
13.16Phosphositeplus
Link
278Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)STMIKGLYG
EEEECCCCC
31.85Phosphositeplus
Link
278N6-acetyllysineSTMIKGLYG
EEEECCCCC
31.85HPRD
Link
278N6-acetyllysineSTMIKGLYG
EEEECCCCC
31.85Phosphositeplus
Link
278N6-acetyllysine.STMIKGLYG
EEEECCCCC
31.85UniProtKB
Link
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LYGIKDDVF
CCCCCCCCE
43.44Phosphositeplus
Link
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ARLKKSADT
HHHHHHHHH
56.31Phosphositeplus
Link
318N6-acetyllysineARLKKSADT
HHHHHHHHH
56.31HPRD
Link
318N6-acetyllysineARLKKSADT
HHHHHHHHH
56.31Phosphositeplus
Link
318N6-acetyllysine.ARLKKSADT
HHHHHHHHH
56.31UniProtKB
Link
328Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WGIQKELQF
HHHHHHHCC
59.48Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
1433Z_HUMANphysical interactionMINT-3304540MINT15161933
LDHA_HUMANin vitroHPRD:01025HPRD11276087
DLDH_HUMANENSP00000227157STRING
LDHB_HUMANENSP00000227157STRING
LDHD_HUMANENSP00000227157STRING
MAOM_HUMANENSP00000227157STRING
CISY_HUMANENSP00000227157STRING
- top -

Disease Reference
Kegg disease
OMIM disease
612933Glycogen storage disease 11 (GSD11)
Drug Reference
There are no disease associations of PTM sites.
- top -
Query failed : Got error 28 from storage engine
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed