Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-lactate dehydrogenase A chain  

UniProtKB / Swiss-Prot ID :  LDHA_HUMAN

Gene Name (Synonyms) : 
LDHA PIG19  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL...
Predicted Secondary Structure CCCHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCC...
Protein Variant
LocationDescription
161S -> R (in dbSNP:rs5030621). VAR_059374
222K -> E. VAR_004180
315R -> C. VAR_004181
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATLKD
---CCCHHH
22.95UniProtKB
Link
5Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MATLKDQLI
CCCHHHHHH
38.79Phosphositeplus
Link
5N6-acetyllysineMATLKDQLI
CCCHHHHHH
38.79HPRD
Link
5N6-acetyllysineMATLKDQLI
CCCHHHHHH
38.79Phosphositeplus
Link
5N6-acetyllysine.MATLKDQLI
CCCHHHHHH
38.79UniProtKB
Link
10PhosphotyrosineDQLIYNLLK
HHHHHHHHC
14.35HPRD
Link
10PhosphotyrosineDQLIYNLLK
HHHHHHHHC
14.35Phosphositeplus
Link
10Phosphotyrosine.DQLIYNLLK
HHHHHHHHC
14.35UniProtKB
Link
14Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YNLLKEEQT
HHHHCCCCC
63.47Phosphositeplus
Link
14N6-acetyllysineYNLLKEEQT
HHHHCCCCC
63.47HPRD
Link
14N6-acetyllysineYNLLKEEQT
HHHHCCCCC
63.47Phosphositeplus
Link
14N6-acetyllysine.YNLLKEEQT
HHHHCCCCC
63.47UniProtKB
Link
57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VIEDKLKGE
CCCCCCHHH
39.03Phosphositeplus
Link
57N6-acetyllysineVIEDKLKGE
CCCCCCHHH
39.03HPRD
Link
57N6-acetyllysineVIEDKLKGE
CCCCCCHHH
39.03Phosphositeplus
Link
57N6-acetyllysine.VIEDKLKGE
CCCCCCHHH
39.03UniProtKB
Link
59Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDKLKGEMM
CCCCHHHHH
59.57Phosphositeplus
Link
76Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LRTPKIVSG
CCCCEEEEC
55.94Phosphositeplus
Link
81Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IVSGKDYNV
EEECCCHHH
49.92Phosphositeplus
Link
81N6-acetyllysineIVSGKDYNV
EEECCCHHH
49.92HPRD
Link
81N6-acetyllysineIVSGKDYNV
EEECCCHHH
49.92Phosphositeplus
Link
81N6-acetyllysine.IVSGKDYNV
EEECCCHHH
49.92UniProtKB
Link
83PhosphotyrosineSGKDYNVTA
ECCCHHHHC
18.28Phosphositeplus
Link
90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TANSKLVII
HCCCCEEEE
46.73Phosphositeplus
Link
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VNIFKFIIP
HHHHHHHHH
31.68Phosphositeplus
Link
118N6-acetyllysineVNIFKFIIP
HHHHHHHHH
31.68HPRD
Link
118N6-acetyllysineVNIFKFIIP
HHHHHHHHH
31.68Phosphositeplus
Link
118N6-acetyllysine.VNIFKFIIP
HHHHHHHHH
31.68UniProtKB
Link
126Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PNVVKYSPN
HHHHHHCCC
35.41Phosphositeplus
Link
126N6-acetyllysinePNVVKYSPN
HHHHHHCCC
35.41HPRD
Link
126N6-acetyllysinePNVVKYSPN
HHHHHHCCC
35.41Phosphositeplus
Link
126N6-acetyllysine.PNVVKYSPN
HHHHHHCCC
35.41UniProtKB
Link
132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPNCKLLIV
CCCEEEEEE
53.63Phosphositeplus
Link
155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SGFPKNRVI
CCCCHHHEE
55.94Phosphositeplus
Link
172PhosphotyrosineARFRYLMGE
HHHHHHHHH
9.79Phosphositeplus
Link
222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGTDKDKEQ
CCCCCCHHH
71.22Phosphositeplus
Link
222N6-acetyllysineLGTDKDKEQ
CCCCCCHHH
71.22HPRD
Link
222N6-acetyllysineLGTDKDKEQ
CCCCCCHHH
71.22Phosphositeplus
Link
222N6-acetyllysine.LGTDKDKEQ
CCCCCCHHH
71.22UniProtKB
Link
232Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEVHKQVVE
HHHHHHHHH
50.38Phosphositeplus
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73HPRD
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73PhosphoELM
Link
239PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73Phosphositeplus
Link
239Phosphotyrosine.VESAYEVIK
HHHHHHHHH
21.73UniProtKB
Link
243Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YEVIKLKGY
HHHHHHHCC
49.69Phosphositeplus
Link
248PhosphothreonineLKGYTSWAI
HHCCCHHHH
26.85Phosphositeplus
Link
249PhosphoserineKGYTSWAIG
HCCCHHHHH
13.16Phosphositeplus
Link
278Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)STMIKGLYG
EEEECCCCC
31.85Phosphositeplus
Link
278N6-acetyllysineSTMIKGLYG
EEEECCCCC
31.85HPRD
Link
278N6-acetyllysineSTMIKGLYG
EEEECCCCC
31.85Phosphositeplus
Link
278N6-acetyllysine.STMIKGLYG
EEEECCCCC
31.85UniProtKB
Link
284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LYGIKDDVF
CCCCCCCCE
43.44Phosphositeplus
Link
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ARLKKSADT
HHHHHHHHH
56.31Phosphositeplus
Link
318N6-acetyllysineARLKKSADT
HHHHHHHHH
56.31HPRD
Link
318N6-acetyllysineARLKKSADT
HHHHHHHHH
56.31Phosphositeplus
Link
318N6-acetyllysine.ARLKKSADT
HHHHHHHHH
56.31UniProtKB
Link
328Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WGIQKELQF
HHHHHHHCC
59.48Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
1433Z_HUMANphysical interactionMINT-3304540MINT15161933
LDHA_HUMANin vitroHPRD:01025HPRD11276087
DLDH_HUMANENSP00000227157STRING
LDHB_HUMANENSP00000227157STRING
LDHD_HUMANENSP00000227157STRING
MAOM_HUMANENSP00000227157STRING
CISY_HUMANENSP00000227157STRING
- top -

Disease Reference
Kegg disease
OMIM disease
612933Glycogen storage disease 11 (GSD11)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-5; LYS-14; LYS-57; LYS-81;LYS-118; LYS-126; LYS-222; LYS-278 AND LYS-318, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, AND MASSSPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-239, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-10 AND TYR-239, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures