Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-lactate dehydrogenase A chain  

UniProtKB / Swiss-Prot ID :  LDHA_RAT

Gene Name (Synonyms) : 
Ldha, Ldh-1, Ldh1  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL...
Predicted Secondary Structure CCCHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAALKD
---CCCHHH
22.85UniProtKB
Link
42N6,N6-dimethyllysineSILMKDLAD
HHHHCCCCC
46.26Phosphositeplus
Link
42N6-methyllysineSILMKDLAD
HHHHCCCCC
46.26MeMo
Link
42N6-methyllysineSILMKDLAD
HHHHCCCCC
46.26Phosphositeplus
Link
57N6,N6-dimethyllysineVIEDKLKGE
CCCCCCCHH
39.03MeMo
Link
57N6,N6-dimethyllysineVIEDKLKGE
CCCCCCCHH
39.03Phosphositeplus
Link
59N6,N6-dimethyllysineEDKLKGEMM
CCCCCHHHH
59.57MeMo
Link
59N6,N6-dimethyllysineEDKLKGEMM
CCCCCHHHH
59.57Phosphositeplus
Link
163S-nitrosocysteineIGSGCNLDS
EECCCHHHH
4.97dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures