Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-lactate dehydrogenase B chain  

UniProtKB / Swiss-Prot ID :  LDHB_HUMAN

Gene Name (Synonyms) : 
LDHB  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS...
Predicted Secondary Structure CCCHHHHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCC...
Protein Variant
LocationDescription
7K -> E (in LDHB deficiency; slightlydecreased activity).
35A -> E (in LDHB deficiency). VAR_004174
69G -> E (in LDHB deficiency). VAR_011634
107R -> W (in LDHB deficiency; inactive). VAR_011635
129S -> R (in LDHB deficiency). VAR_004175
171F -> V (in LDHB deficiency). VAR_004176
172R -> H (in LDHB deficiency; unstable). VAR_004177
172R -> P (in LDHB deficiency). VAR_011636
175M -> L (in LDHB deficiency). VAR_004178
175M -> V (in dbSNP:rs7966339). VAR_049758
223Missing (in LDHB deficiency). VAR_011637
322D -> V (in LDHB deficiency). VAR_004179
325W -> R (in LDHB deficiency). VAR_011638
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATLKE
---CCCHHH
22.95UniProtKB
Link
7Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TLKEKLIAP
CHHHHHHHH
43.54Phosphositeplus
Link
7N6-acetyllysineTLKEKLIAP
CHHHHHHHH
43.54HPRD
Link
7N6-acetyllysineTLKEKLIAP
CHHHHHHHH
43.54Phosphositeplus
Link
7N6-acetyllysine.TLKEKLIAP
CHHHHHHHH
43.54UniProtKB
Link
44PhosphoserineILGKSLADE
HHHCCCCCE
27.30HPRD
Link
44PhosphoserineILGKSLADE
HHHCCCCCE
27.30Phosphositeplus
Link
58Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VLEDKLKGE
CCCCCCHHH
42.60Phosphositeplus
Link
58N6-acetyllysineVLEDKLKGE
CCCCCCHHH
42.60HPRD
Link
58N6-acetyllysineVLEDKLKGE
CCCCCCHHH
42.60Phosphositeplus
Link
58N6-acetyllysine.VLEDKLKGE
CCCCCCHHH
42.60UniProtKB
Link
60Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDKLKGEMM
CCCCHHHHH
59.57Phosphositeplus
Link
77Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQTPKIVAD
HCCCEEEEC
53.88Phosphositeplus
Link
82Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IVADKDYSV
EEECCCHHH
49.15Phosphositeplus
Link
119Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VNVFKFIIP
HHHHHHHHH
31.22Phosphositeplus
Link
119N6-acetyllysineVNVFKFIIP
HHHHHHHHH
31.22HPRD
Link
119N6-acetyllysineVNVFKFIIP
HHHHHHHHH
31.22Phosphositeplus
Link
119N6-acetyllysine.VNVFKFIIP
HHHHHHHHH
31.22UniProtKB
Link
173PhosphotyrosineARFRYLMAE
HHHHHHHHH
9.71Phosphositeplus
Link
233Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KEVHKMVVE
HHHHHHHHH
38.27Phosphositeplus
Link
240PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73HPRD
Link
240PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73PhosphoELM
Link
240PhosphotyrosineVESAYEVIK
HHHHHHHHH
21.73Phosphositeplus
Link
240Phosphotyrosine.VESAYEVIK
HHHHHHHHH
21.73UniProtKB
Link
244Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YEVIKLKGY
HHHHHHHCC
49.69Phosphositeplus
Link
248PhosphotyrosineKLKGYTNWA
HHHCCCHHH
8.70Phosphositeplus
Link
248Phosphotyrosine.KLKGYTNWA
HHHCCCHHH
8.70UniProtKB
Link
249PhosphothreonineLKGYTNWAI
HHCCCHHHH
32.71Phosphositeplus
Link
249Phosphothreonine.LKGYTNWAI
HHCCCHHHH
32.71UniProtKB
Link
308Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VINQKLKDD
EECCCCCHH
53.68Phosphositeplus
Link
310Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NQKLKDDEV
CCCCCHHHH
70.89Phosphositeplus
Link
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VAQLKKSAD
HHHHHHHHH
32.38Phosphositeplus
Link
319Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQLKKSADT
HHHHHHHHH
60.51Phosphositeplus
Link
319N6-acetyllysineAQLKKSADT
HHHHHHHHH
60.51HPRD
Link
319N6-acetyllysineAQLKKSADT
HHHHHHHHH
60.51Phosphositeplus
Link
319N6-acetyllysine.AQLKKSADT
HHHHHHHHH
60.51UniProtKB
Link
329Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WDIQKDLKD
HHHHHHHHC
66.42Phosphositeplus
Link
329N6-acetyllysineWDIQKDLKD
HHHHHHHHC
66.42HPRD
Link
329N6-acetyllysineWDIQKDLKD
HHHHHHHHC
66.42Phosphositeplus
Link
329N6-acetyllysine.WDIQKDLKD
HHHHHHHHC
66.42UniProtKB
Link
332Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QKDLKDL
HHHHHCC
68.09Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
LDHB_HUMANin vitroHPRD:01026HPRD11276087
DLDH_HUMANENSP00000229319STRING
LDHA_HUMANENSP00000229319STRING
TPIS_HUMANENSP00000229319STRING
LDHD_HUMANENSP00000229319STRING
MAOM_HUMANENSP00000229319STRING
CISY_HUMANENSP00000229319STRING
- top -

Disease Reference
Kegg disease
OMIM disease
614128Lactate dehydrogenase B deficiency (LDHBD)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-7; LYS-58; LYS-119; LYS-319AND LYS-329, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240; TYR-248 ANDTHR-249, AND MASS SPECTROMETRY.
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240, AND MASSSPECTROMETRY.
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240, AND MASSSPECTROMETRY.
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells.";
Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.;
J. Proteome Res. 8:3852-3861(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures