Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  L-lactate dehydrogenase B chain  

UniProtKB / Swiss-Prot ID :  LDHB_MOUSE

Gene Name (Synonyms) : 
Ldhb, Ldh-2, Ldh2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MATLKEKLIASVADDEAAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS...
Predicted Secondary Structure CCHHHHHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
11PhosphoserineKLIASVADD
HHHHHHHCC
15.73Phosphositeplus
Link-
36S-nitrosocysteineVGMACAISI
HHHHHHHHH
2.28dbSNO
Link-
44PhosphoserineILGKSLADE
HHCCCCCCE
27.30Phosphositeplus
Link-
164S-nitrosocysteineIGSGCNLDS
EEECCHHHH
4.97dbSNO
Link-
240PhosphotyrosineVDSAYEVIK
HHHHHHHHH
18.06Phosphositeplus
Link-
240PhosphotyrosineVDSAYEVIK
HHHHHHHHH
18.06SysPTM
Link-
240Phosphotyrosine.VDSAYEVIK
HHHHHHHHH
18.06UniProtKB
Link-
294S-nitrosocysteineLSLPCILNA
EEEEEEECC
7.20dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures