Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lectin  

UniProtKB / Swiss-Prot ID :  LEC_ERYCO

Gene Name (Synonyms) :  -
 

Species :  Erythrina corallodendrum (Coral tree). 

Subcellular Localization :   

Protein Function :  Galactose and N-acetyllactosamine specific lectin. Binds to the H-2 blood type determinant fucosyl-N-acetyllactosamine. 

Protein Sequence MATYKLCSVLALSLTLFLLILNKVNSVETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPA...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCEEEEEECEEECCCCEEEEEECCCCCCCC...
Protein Variant
LocationDescription
48G -> A.
160P -> Q.
225D -> V.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
43N-linked (GlcNAc...).PGNDNLTLQ
CCCCEEEEE
38.64UniProtKB
Link
139N-linked (GlcNAc...).LGIFNNSKQ
EEEECCCCC
50.36UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"C-terminal post-translational proteolysis of plant lectins and theirrecombinant forms expressed in Escherichia coli. Characterization of'ragged ends' by mass spectrometry.";
Young N.M., Watson D.C., Yaguchi M., Adar R., Arango R.,Rodriguez-Arango E., Sharon N., Blay P.K., Thibault P.;
J. Biol. Chem. 270:2563-2570(1995).
Cited for: PROTEIN SEQUENCE OF 27-55; 77-99; 126-166 AND 247-267, VARIANTGLN-160, PROTEOLYTIC PROCESSING, AND GLYCOSYLATION.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures