Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Galectin-3  

UniProtKB / Swiss-Prot ID :  LEG3_CANFA

Gene Name (Synonyms) : 
LGALS3  

Species :  Canis familiaris (Dog) (Canis lupus familiaris). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). Secreted (By similarity). Note=Secreted by a non- classical secretory pathway and associates with the cell surface (By similarity). 

Protein Function :  Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells (By similarity). 

Protein Sequence MADSFSLNDALSGSGNPNPQGWPGPWGNQPAGAGGYPGASYPGAYPGQAPPGGYPGQAPPGGYPGQAPPG...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADSFS
---CCCCCC
22.58UniProtKB
Link-
6PhosphoserineADSFSLNDA
CCCCCCCCC
30.16Phosphositeplus
Link-
6Phosphoserine (CK1_group)ADSFSLNDA
CCCCCCCCC
30.16PhosphoELM
Link-
6Phosphoserine; by CK1.ADSFSLNDA
CCCCCCCCC
30.16UniProtKB
Link-
12PhosphoserineNDALSGSGN
CCCCCCCCC
32.41Phosphositeplus
Link-
12Phosphoserine (CK1_group)NDALSGSGN
CCCCCCCCC
32.41PhosphoELM
Link-
12Phosphoserine; by CK1.NDALSGSGN
CCCCCCCCC
32.41UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6and serine 12 in vivo and by casein kinase I.";
Huflejt M.E., Turck C.W., Lindstedt R., Barondes S.H., Leffler H.;
J. Biol. Chem. 268:26712-26718(1993).
Cited for: PHOSPHORYLATION AT SER-6 AND SER-12.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures