Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Galectin-3  

UniProtKB / Swiss-Prot ID :  LEG3_HUMAN

Gene Name (Synonyms) : 
LGALS3, MAC2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Secreted. Note=Secreted by a non-classical secretory pathway and associates with the cell surface. 

Protein Function :  Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. 

Protein Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAY...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
64P -> H (in dbSNP:rs4644). VAR_012988
98T -> P (in dbSNP:rs4652). VAR_012989
183R -> K (in dbSNP:rs10148371). VAR_049768
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
6PhosphoserineADNFSLHDA
CCCCCCCCC
30.92Phosphositeplus
Link-
6Phosphoserine (CK1_alpha;CK1_alpha)ADNFSLHDA
CCCCCCCCC
30.92PhosphoELM
Link-
6Phosphoserine (CSNK1A1)ADNFSLHDA
CCCCCCCCC
30.92HPRD
Link-
6Phosphoserine (CSNK2A1)ADNFSLHDA
CCCCCCCCC
30.92HPRD
Link-
6Phosphoserine (CSNK2A2)ADNFSLHDA
CCCCCCCCC
30.92HPRD
Link-
6Phosphoserine.ADNFSLHDA
CCCCCCCCC
30.92UniProtKB
Link-
12PhosphoserineHDALSGSGN
CCCCCCCCC
32.41Phosphositeplus
Link-
12Phosphoserine (CK1_alpha)HDALSGSGN
CCCCCCCCC
32.41PhosphoELM
Link-
12Phosphoserine (CSNK1A1)HDALSGSGN
CCCCCCCCC
32.41HPRD
Link-
12Phosphoserine (CSNK2A1)HDALSGSGN
CCCCCCCCC
32.41HPRD
Link-
12Phosphoserine (CSNK2A2)HDALSGSGN
CCCCCCCCC
32.41HPRD
Link-
12Phosphoserine.HDALSGSGN
CCCCCCCCC
32.41UniProtKB
Link-
79PhosphotyrosineAPGVYPGPP
CCCCCCCCC
14.37Phosphositeplus
Link-
107PhosphotyrosineATGPYGAPA
CCCCCCCCC
27.54Phosphositeplus
Link-
118PhosphotyrosineLIVPYNLPL
CCCCCCCCC
20.59Phosphositeplus
Link
133PhosphothreonineRMLITILGT
CCEEEEEEE
13.24HPRD
Link
247PhosphotyrosineTSASYTMI
EEEEEECC
10.47Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ELN_HUMANin vitro
in vivo
HPRD:01090HPRD10536372
FCG2A_HUMANin vitroHPRD:01090HPRD10704522
LG3BP_HUMANENSP00000254301STRING
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"L-29, a soluble lactose-binding lectin, is phosphorylated on serine 6and serine 12 in vivo and by casein kinase I.";
Huflejt M.E., Turck C.W., Lindstedt R., Barondes S.H., Leffler H.;
J. Biol. Chem. 268:26712-26718(1993).
Cited for: PHOSPHORYLATION AT SER-6 AND SER-12.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures