Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Blue-light-activated histidine kinase  

UniProtKB / Swiss-Prot ID :  LOVHK_BRUME

Gene Name (Synonyms) : 
BMEII0679  

Species :  Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094). 

Subcellular Localization :   

Protein Function :  Photosensitive kinase that is involved in increased bacterial virulence upon exposure to light. Once ejected from an infected animal host, sunlight acts as an environmental signal that increases the virulence of the bacterium, preparing it for infection of the next host. This photoreceptor protein is directly related to the bacterium's survival and replication within host macrophages. 

Protein Sequence MAIDLRPFIPFGRGALSQATDPFRAAVEFTLMPMLITNPHLPDNPIVFANPAFLKLTGYEADEVMGRNCR...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
69S-4a-FMN cysteine.MGRNCRFLQ
2.91UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures