Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  U6 snRNA-associated Sm-like protein LSm3  

UniProtKB / Swiss-Prot ID :  LSM3_HUMAN

Gene Name (Synonyms) : 
LSM3 MDS017  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus (Potential). 

Protein Function :  Binds specifically to the 3'-terminal U-tract of U6 snRNA. 

Protein Sequence MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET...
Predicted Secondary Structure CCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEEEEEEECCCCEEEEECEEEEEEECCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADDVD
---CCCCCH
23.01UniProtKB
Link-
10PhosphothreonineDQQQTTNTV
HHHHHHHHH
20.06HPRD
Link-
10PhosphothreonineDQQQTTNTV
HHHHHHHHH
20.06Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GDF9_HUMANphysical interactionMINT-63958MINT16169070
LSM10_HUMANphysical interactionMINT-68460MINT16189514
LSM2_HUMANphysical interactionMINT-62591MINT14667819
LSM2_HUMANphysical interactionMINT-62689MINT14667819
LSM2_HUMANphysical interactionMINT-62765MINT14667819
LSM2_HUMANphysical interactionMINT-68452MINT16189514
GDF9_HUMANphysical interactionEBI-729045
intact16169070
EF1A1_HUMANphysical interactionEBI-728543
intact16169070
UT14A_HUMANphysical interactionEBI-728546
intact16169070
LSM10_HUMANphysical interaction
physical interaction
EBI-760390
EBI-373902
intact16189514
15231747
LSM5_HUMANphysical interaction
physical interaction
physical interaction
EBI-374394
EBI-374415
EBI-373
intact15231747
15231747
15231747
LSM6_HUMANphysical interaction
physical interaction
physical interaction
EBI-374397
EBI-374424
EBI-373
intact15231747
15231747
15231747
LSM7_HUMANphysical interaction
physical interaction
physical interaction
EBI-374400
EBI-374439
EBI-373
intact15231747
15231747
15231747
LSM8_HUMANphysical interaction
physical interaction
physical interaction
EBI-374403
EBI-374460
EBI-373
intact15231747
15231747
15231747
XRN2_HUMANphysical interactionEBI-374406
intact15231747
SMD3_HUMANphysical interactionEBI-373905
intact15231747
RUXE_HUMANphysical interactionEBI-373908
intact15231747
XPC_HUMANphysical interactionEBI-373914
intact15231747
CCD45_HUMANphysical interactionEBI-373917
intact15231747
RUXE_HUMANyeast 2-hybridHPRD:06283HPRD15231747
UT14A_HUMANyeast 2-hybridHPRD:06283HPRD16169070
XPC_HUMANyeast 2-hybridHPRD:06283HPRD15231747
SMD3_HUMANyeast 2-hybridHPRD:06283HPRD15231747
SMN_HUMANin vitroHPRD:06283HPRD10851237
LSM1_HUMANin vitroHPRD:06283HPRD11920408
LSM2_HUMANin vitro
yeast 2-hybrid
HPRD:06283HPRD11920408
15231747
14667819
SMD3_HUMANENSP00000302160STRING
LSM5_HUMANENSP00000302160STRING
LSM2_HUMANENSP00000302160STRING
LSM8_HUMANENSP00000302160STRING
LSM4_HUMANENSP00000302160STRING
XRN1_HUMANENSP00000302160STRING
LSM6_HUMANENSP00000302160STRING
LSM1_HUMANENSP00000302160STRING
LSM10_HUMANENSP00000302160STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures