Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Leukotriene C4 synthase  

UniProtKB / Swiss-Prot ID :  LTC4S_HUMAN

Gene Name (Synonyms) : 
LTC4S  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. 

Protein Function :  Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4. 

Transmembrane Topology (topPTM) : LTC4S_HUMAN 

Protein Sequence MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCHHHHHHHHHHCCHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
142R -> Q (in dbSNP:rs11541078). VAR_042736
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
109PhosphotyrosineLAPLYASAR
CHHHHHHHH
9.46Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MGST1_HUMANin vitro
in vivo
HPRD:02004HPRD11034337
7663172
LTC4S_HUMANin vitroHPRD:02004HPRD10591082
LKHA4_HUMANENSP00000292596STRING
IL4_HUMANENSP00000292596STRING
SP1_HUMANENSP00000292596STRING
GGT5_HUMANENSP00000292596STRING
GGT4_HUMANENSP00000292596STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00143Glutathione
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures