Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lymphocyte antigen 6 complex locus protein G6c  

UniProtKB / Swiss-Prot ID :  LY66C_MOUSE

Gene Name (Synonyms) : 
Ly6g6c, Ng24  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (By similarity). 

Protein Function :   

Protein Sequence MKHLLLLTLSALLYCWVSADTRCHSCYKVPVLGCVDRQSCRLEPGHKCLTTNVYLGKMWVFSNLRCGTPE...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
89N-linked (GlcNAc...)GLNYNTTCC
28.04SysPTM
Link-
89N-linked (GlcNAc...) (high mannose).GLNYNTTCC
28.04UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"High throughput quantitative glycomics and glycoform-focusedproteomics of murine dermis and epidermis.";
Uematsu R., Furukawa J., Nakagawa H., Shinohara Y., Deguchi K.,Monde K., Nishimura S.;
Mol. Cell. Proteomics 4:1977-1989(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-89, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures