Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lysophospholipase-like protein 1  

UniProtKB / Swiss-Prot ID :  LYPL1_HUMAN

Gene Name (Synonyms) : 
LYPLAL1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  Does not exhibit phospholipase nor triacylglycerol lipase activity, able to hydrolyze only short chain substrates due to its shallow active site. 

Protein Sequence MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMK...
Predicted Secondary Structure CCCCCHHHHHHHCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEECCCCCEEEEECCC...
Protein Variant
LocationDescription
131I -> M (in dbSNP:rs940570). VAR_025607
197L -> V (in dbSNP:rs34201999). VAR_060992
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAASG
---CCCCCH
16.25UniProtKB
Link-
55Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FQHIKIIYP
CCCCEEECC
22.41Phosphositeplus
Link
70Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YTPMKGGIS
EECCCCCCC
56.01Phosphositeplus
Link
228Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WILTKLPGE
HHHHHCCCC
49.60Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures