Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lysozyme C  

UniProtKB / Swiss-Prot ID :  LYSC_CHICK

Gene Name (Synonyms) : 
LYZ  

Species :  Gallus gallus (Chicken). 

Subcellular Localization :  Secreted. 

Protein Function :  Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. 

Protein Sequence MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTD...
Predicted Secondary Structure CHHHHHHHHHHHHCCCCCEECCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
42Phosphoserine (PKA_group)YRGYSLGNW
CCCCCHHHH
32.40PhosphoELM
Link
68Phosphoserine (PKA_group)NTDGSTDYG
CCCCCCCEE
22.40PhosphoELM
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures