Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Leucine-zipper-like transcriptional regulator 1  

UniProtKB / Swiss-Prot ID :  LZTR1_HUMAN

Gene Name (Synonyms) : 
LZTR1, TCFL2  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Probable transcriptional regulator that may play a crucial role in embryogenesis. 

Protein Sequence MAGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSK...
Predicted Secondary Structure CCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCEEECCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
352PhosphotyrosinePTLTYEERV
EEEEEEECC
20.93Phosphositeplus
Link-
375Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TTSAKQPTQ
CCCCCCCCC
57.48Phosphositeplus
Link-
484Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RLAQKLEQE
HHHHHHHCC
48.67Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
OMIM disease
615670Schwannomatosis 2 (SWNTS2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures