Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Mitochondrial 2-oxoglutarate/malate carrier protein  

UniProtKB / Swiss-Prot ID :  M2OM_MOUSE

Gene Name (Synonyms) : 
Slc25a11  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Mitochondrion inner membrane; Multi-pass membrane protein (By similarity). 

Protein Function :  Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism (By similarity). 

Transmembrane Topology (topPTM) : M2OM_MOUSE 

Protein Sequence MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
102PhosphotyrosineRLGIYTVLF
HHHHHHHHH
6.76Phosphositeplus
Link-
102PhosphotyrosineRLGIYTVLF
HHHHHHHHH
6.76SysPTM
Link-
102Phosphotyrosine.RLGIYTVLF
HHHHHHHHH
6.76UniProtKB
Link-
184S-nitrosocysteineLWRGCIPTM
HHHHHHHHH
2.24dbSNO
Link-
202PhosphotyrosineQLASYSQSK
HHHHHHHHH
12.72Phosphositeplus
Link-
202PhosphotyrosineQLASYSQSK
HHHHHHHHH
12.72SysPTM
Link-
202Phosphotyrosine.QLASYSQSK
HHHHHHHHH
12.72UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain.";
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.;
J. Proteome Res. 7:311-318(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-102 AND TYR-202, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures