Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Mitogen-activated protein kinase-binding protein 1  

UniProtKB / Swiss-Prot ID :  MABP1_HUMAN

Gene Name (Synonyms) : 
MAPKBP1, JNKBP1, KIAA0596  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Involved in JNK signaling pathway (By similarity). 

Protein Sequence MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGC...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
204Y -> S (in dbSNP:rs4354909). VAR_043343
313L -> V (in dbSNP:rs1201689). VAR_043344
1240R -> P (in dbSNP:rs3959569). VAR_043345
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures