Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1  

UniProtKB / Swiss-Prot ID :  MAGI1_HUMAN

Gene Name (Synonyms) : 
MAGI1, AIP3, BAIAP1, BAP1, TNRC19  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell junction, tight junction. Cell membrane; Peripheral membrane protein. Note=Localizes to epithelial cells tight junctions. 

Protein Function :  May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface (By similarity). 

Protein Sequence MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELL...
Predicted Secondary Structure CCCCCCCCCCCCHHHHHHHHCCCCCCEEEEEEECCCCCCCCCEEEEECCCEEEECCCCCCCCEEECEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
376PhosphotyrosineVYGIYYVDH
CCCEEEEEC
7.96Phosphositeplus
Link-
376Phosphotyrosine.VYGIYYVDH
CCCEEEEEC
7.96UniProtKB
Link-
500PhosphoserineLQIKSLVLD
EEEEEECCC
25.91Phosphositeplus
Link
730PhosphoserineVPKKSPKSQ
CCCCCCCCC
43.62Phosphositeplus
Link-
741PhosphoserineERKDSQNSS
CCCCCCCCC
34.01Phosphositeplus
Link-
748PhosphoserineSSQHSVSSH
CCCCCCCCC
18.96Phosphositeplus
Link-
1177PhosphotyrosineNMDLYVLRL
CCCEEEEEE
7.99Phosphositeplus
Link-
1361PhosphoserineEGTRSADNT
CCCCCCCCC
39.55Phosphositeplus
Link-
1365PhosphothreonineSADNTLERR
CCCCCCCCC
30.46Phosphositeplus
Link-
1379PhosphoserineRRDVSPERR
CCCCCCCCC
25.90Phosphositeplus
Link-
1486PhosphoserineYKECSTDLS
CCCCCCCCC
26.50Phosphositeplus
Link-
1490PhosphoserineSTDLSI
CCCCCC
29.12Phosphositeplus
Link-
1490Phosphoserine.STDLSI
CCCCCC
29.12UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AP2A_HUMANphysical interactionMINT-18268MINT9169421
RASA1_HUMANphysical interactionMINT-19293MINT9169421
CLCN5_HUMANphysical interactionMINT-18618MINT9169421
ASPP2_HUMANphysical interactionMINT-18159MINT9169421
DAG1_HUMANphysical interactionMINT-17991MINT9169421
FCSD2_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
EBI-1215638
EBI-1215744
EBI-1
intact14627983
14627983
14627983
14627983
14627983
ADRB1_HUMANdirect interactionEBI-991002
intact16316992
AP2A_HUMANin vitroHPRD:04020HPRD9169421
DAG1_HUMANin vitroHPRD:04020HPRD9169421
RASA1_HUMANin vitroHPRD:04020HPRD9169421
IL6RA_HUMANin vitroHPRD:04020HPRD9169421
CLCN5_HUMANin vitroHPRD:04020HPRD9169421
LRP2_HUMANin vitro
yeast 2-hybrid
HPRD:04020HPRD11274227
KS6A3_HUMANyeast 2-hybridHPRD:04020HPRD16217014
KS6A2_HUMANyeast 2-hybridHPRD:04020HPRD16217014
KS6A1_HUMANyeast 2-hybridHPRD:04020HPRD16217014
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1490, AND MASSSPECTROMETRY.
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells.";
Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.;
J. Proteome Res. 8:3852-3861(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-376, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures