Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  NAD-dependent malic enzyme, mitochondrial  

UniProtKB / Swiss-Prot ID :  MAOM_HUMAN

Gene Name (Synonyms) : 
ME2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion matrix. 

Protein Function :   

Protein Sequence MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR...
Predicted Secondary Structure CCHHHHHHHHHCCCCCCCEECCCCCHHHHHCCCCCCCCCCCHHHHHHCCCEECCCCCCCCHHHHHHHHHH...
Protein Variant
LocationDescription
114P -> L (in dbSNP:rs16952692). VAR_034104
450G -> E (in dbSNP:rs649224). VAR_050017
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
94N6-acetyllysineERNEKLFYR
HHCCHHHHH
47.66HPRD
Link
94N6-acetyllysineERNEKLFYR
HHCCHHHHH
47.66Phosphositeplus
Link
156N6-acetyllysineENHVKAVVV
CCCEEEEEE
28.10HPRD
Link
156N6-acetyllysineENHVKAVVV
CCCEEEEEE
28.10Phosphositeplus
Link
156N6-acetyllysine.ENHVKAVVV
CCCEEEEEE
28.10UniProtKB
Link
224N6-acetyllysineGLYQKRDRT
CCCCCCCCH
42.59HPRD
Link
224N6-acetyllysineGLYQKRDRT
CCCCCCCCH
42.59Phosphositeplus
Link
224N6-acetyllysine.GLYQKRDRT
CCCCCCCCH
42.59UniProtKB
Link
240N6-acetyllysineDEFMKAITD
HHHHHHHHH
41.79HPRD
Link
240N6-acetyllysineDEFMKAITD
HHHHHHHHH
41.79Phosphositeplus
Link
240N6-acetyllysine.DEFMKAITD
HHHHHHHHH
41.79UniProtKB
Link
272N6-acetyllysineKYREKYCTF
HHHHCCCCC
36.31HPRD
Link
272N6-acetyllysineKYREKYCTF
HHHHCCCCC
36.31Phosphositeplus
Link
272N6-acetyllysine.KYREKYCTF
HHHHCCCCC
36.31UniProtKB
Link
346N6-acetyllysineWMFDKYGLL
EEEECCCCE
29.92HPRD
Link
346N6-acetyllysineWMFDKYGLL
EEEECCCCE
29.92Phosphositeplus
Link
346N6-acetyllysine.WMFDKYGLL
EEEECCCCE
29.92UniProtKB
Link
441S-nitrosocysteineTEGRCLFAS
CCCCEEECC
5.57dbSNO
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
UBP15_HUMANphysical interactionEBI-1061890
intact17353931
PUR9_HUMANphysical interactionEBI-1073339
intact17353931
RB11A_HUMANphysical interactionEBI-1071108
intact17353931
WNK1_HUMANphysical interactionEBI-1065933
intact17353931
MAOM_HUMANin vitroHPRD:01103HPRD10700286
10913357
12121650
12962632
DLDH_HUMANENSP00000321070STRING
LDHA_HUMANENSP00000321070STRING
ODPX_HUMANENSP00000321070STRING
LDHB_HUMANENSP00000321070STRING
MDHC_HUMANENSP00000321070STRING
KPYR_HUMANENSP00000321070STRING
ODP2_HUMANENSP00000321070STRING
LDHC_HUMANENSP00000321070STRING
LDH6A_HUMANENSP00000321070STRING
ODPAT_HUMANENSP00000321070STRING
ODPAT_HUMANENSP00000321070STRING
ODPAT_HUMANENSP00000321070STRING
LDHD_HUMANENSP00000321070STRING
LDH6B_HUMANENSP00000321070STRING
ODPB_HUMANENSP00000321070STRING
MDHM_HUMANENSP00000321070STRING
KPYM_HUMANENSP00000321070STRING
KPYM_HUMANENSP00000321070STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-156; LYS-224; LYS-240;LYS-272 AND LYS-346, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures