Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Microtubule-associated protein 1B  

UniProtKB / Swiss-Prot ID :  MAP1B_RAT

Gene Name (Synonyms) : 
Map1b  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm, cytoskeleton (Probable). Cytoplasm (By similarity). Cell junction, synapse (By similarity). Cell projection, dendritic spine (By similarity). Note=Colocalizes with DAPK1 in the microtubules and cortical actin fibers (By similarity). 

Protein Function :  Phosphorylated MAP1B may play a role in the cytoskeletal changes that accompany neurite extension. Possibly MAP1B Binds to at least two tubulin subunits in the polymer, and this bridging of subunits might be involved in nucleating microtubule polymerization and in stabilizing microtubules. Acts as a positive cofactor in DAPK1-mediated autophagic vesicle formation and membrane blebbing. Facilitates tyrosination of alpha-tubulin in neuronal microtubules. Required for synaptic maturation (By similarity). 

Protein Sequence MATVVVEATEPEPSGSIGNPAATTSPSLSHRFLDSKFYLLVVVGETVTEEHLRRAIGNIELGIRSWETNL...
Predicted Secondary Structure CCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
543PhosphoserineDSRESLKPA
CCCCCCCCC
40.35Phosphositeplus
Link-
823PhosphoserineRSLMSSPED
CCCCCCCCC
48.29Phosphositeplus
Link-
824PhosphoserineSLMSSPEDL
CCCCCCCCC
20.53Phosphositeplus
Link-
1251PhosphoserineSPSLSPSPP
CCCCCCCCC
27.89Phosphositeplus
Link-
1251Phosphoserine.SPSLSPSPP
CCCCCCCCC
27.89UniProtKB
Link-
1256PhosphoserinePSPPSPIEK
CCCCCCCCC
41.72Phosphositeplus
Link-
1256Phosphoserine.PSPPSPIEK
CCCCCCCCC
41.72UniProtKB
Link-
1261PhosphothreoninePIEKTPLGE
CCCCCCCCC
15.79Phosphositeplus
Link-
1370PhosphoserineRSSISPMDE
CCCCCCCCC
19.00Phosphositeplus
Link-
1381PhosphoserinePDSESPIEK
CCCCCCCCC
34.82Phosphositeplus
Link-
1388PhosphoserineEKVLSPLRS
CCCCCCCCC
25.52Phosphositeplus
Link-
1392PhosphoserineSPLRSPPLI
CCCCCCCCC
38.25Phosphositeplus
Link-
1493PhosphoserineGGDGSPTQV
CCCCCCCCC
29.52Phosphositeplus
Link-
1493Phosphoserine.GGDGSPTQV
CCCCCCCCC
29.52UniProtKB
Link-
1644PhosphoserineFGQESPEHS
CCCCCCCCC
27.92Phosphositeplus
Link-
1770PhosphoserineGEKLSPKSD
CCCCCCCCC
41.15Phosphositeplus
Link-
1783PhosphoserineTPRESSPTY
CCCCCCCCC
42.78Phosphositeplus
Link-
1784PhosphoserinePRESSPTYS
CCCCCCCCC
19.26Phosphositeplus
Link-
1788PhosphoserineSPTYSPGFS
CCCCCCCCC
22.48Phosphositeplus
Link-
1872PhosphoserineSTTESPDEE
CCCCCCCCC
35.24Phosphositeplus
Link-
1906PhosphoserineRTIKSPCDS
CCCCCCCCC
27.23Phosphositeplus
Link-
1906Phosphoserine.RTIKSPCDS
CCCCCCCCC
27.23UniProtKB
Link-
1940PhosphothreonineKTTRTPEEG
CCCCCCCCC
32.72Phosphositeplus
Link-
2262PhosphoserinePSAASPKPG
CCCCCCCCC
32.92Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites.";
Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.;
Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1251; SER-1256; SER-1493AND SER-1906, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures