Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Microtubule-associated protein 4  

UniProtKB / Swiss-Prot ID :  MAP4_RAT

Gene Name (Synonyms) : 
Map4  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm, cytoskeleton (By similarity). 

Protein Function :  Non-neuronal microtubule-associated protein. Promotes microtubule assembly (By similarity). 

Protein Sequence MADLSLVDALTEPPPEIEGEIKRDFMAALEAEPYDDIVGETVEKTEFIPLLDGDEKSGNSESKRKPCVDT...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
780PhosphothreonineKTTPTISKA
35.47Phosphositeplus
Link-
780PhosphothreonineKTTPTISKA
35.47SysPTM
Link-
782PhosphoserineTPTISKATS
20.79Phosphositeplus
Link-
782PhosphoserineTPTISKATS
20.79SysPTM
Link-
788PhosphoserineATSPSTLVS
33.85Phosphositeplus
Link-
788PhosphoserineATSPSTLVS
33.85SysPTM
Link-
792PhosphoserineSTLVSTGSS
30.11SysPTM
Link-
793PhosphothreonineTLVSTGSSS
33.34SysPTM
Link-
795PhosphoserineVSTGSSSRS
25.81Phosphositeplus
Link-
795PhosphoserineVSTGSSSRS
25.81SysPTM
Link-
899PhosphothreonineSRLATTVSA
32.11Phosphositeplus
Link-
899PhosphothreonineSRLATTVSA
32.11SysPTM
Link-
899Phosphothreonine.SRLATTVSA
32.11UniProtKB
Link-
902PhosphoserineATTVSAPDL
31.80Phosphositeplus
Link-
902PhosphoserineATTVSAPDL
31.80SysPTM
Link-
902Phosphoserine.ATTVSAPDL
31.80UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites.";
Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.;
Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-899 AND SER-902, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures