Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Microtubule-associated protein RP/EB family member 1  

UniProtKB / Swiss-Prot ID :  MARE1_BOVIN

Gene Name (Synonyms) : 
MAPRE1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cytoplasm (By similarity). Cytoplasm, cytoskeleton (By similarity). Cytoplasm, cytoskeleton, centrosome (By similarity). Note=Associated with the microtubule network at the growing distal tip of microtubules. Also enriched at the centrosome (By similarit 

Protein Function :  Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity). 

Protein Sequence MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE...
Predicted Secondary Structure CEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCHHHHHHCCCHHHHHHHHHHCCCCCCHHEEEEHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures