Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Methyltransferase-like protein 2B  

UniProtKB / Swiss-Prot ID :  MET2B_HUMAN

Gene Name (Synonyms) : 
METTL2B  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Probable methyltransferase (By similarity). 

Protein Sequence MAGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQRVCQEKQVDY...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
68V -> I (in dbSNP:rs2288557). VAR_059465
124C -> R (in dbSNP:rs2896399). VAR_042547
129N -> H (in dbSNP:rs2023329). VAR_042548
169E -> K (in dbSNP:rs1065267). VAR_042549
266V -> I (in dbSNP:rs2562741). VAR_042550
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGSYP
---
18.68UniProtKB
Link-
151Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLEHKTQTP
32.71Phosphositeplus
Link-
154PhosphothreonineHKTQTPPVE
34.49HPRD
Link-
154PhosphothreonineHKTQTPPVE
34.49Phosphositeplus
Link-
154PhosphothreonineHKTQTPPVE
34.49SysPTM
Link-
154Phosphothreonine.HKTQTPPVE
34.49UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-154, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-154, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures