Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Macrophage migration inhibitory factor  

UniProtKB / Swiss-Prot ID :  MIF_HUMAN

Gene Name (Synonyms) : 
MIF, GLIF, MMIF  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. Cytoplasm. Note=Does not have a cleavable signal sequence and is secreted via a specialized, non- classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. 

Protein Function :  Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti- inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. 

Protein Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG...
Predicted Secondary Structure CCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCHHEEEEECCCCCEECCCCCCCEEEEEEEECEEECH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8PhosphothreonineFIVNTNVPR
EEEECCCCC
27.05Phosphositeplus
Link
37PhosphotyrosineKPPQYIAVH
CCCHHEEEE
9.16HPRD
Link
37PhosphotyrosineKPPQYIAVH
CCCHHEEEE
9.16Phosphositeplus
Link
37Phosphotyrosine.KPPQYIAVH
CCCHHEEEE
9.16UniProtKB
Link
78Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RSYSKLLCG
HHHHHHHHH
36.93Phosphositeplus
Link
78N6-acetyllysineRSYSKLLCG
HHHHHHHHH
36.93HPRD
Link
78N6-acetyllysineRSYSKLLCG
HHHHHHHHH
36.93Phosphositeplus
Link
78N6-acetyllysine.RSYSKLLCG
HHHHHHHHH
36.93UniProtKB
Link
81S-nitrosocysteineSKLLCGLLA
HHHHHHHHH
5.38dbSNO
Link
91PhosphoserineRLRISPDRV
HHCCCCCEE
17.83Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q53TE3_HUMANphysical interactionMINT-66575MINT16189514
CSN6_HUMANphysical interactionMINT-58212MINT15757663
BNIPL_HUMANphysical interactionMINT-14209MINT12681488
GORS2_HUMANphysical interactionEBI-754225
intact16189514
HG2A_HUMANin vitro
in vivo
HPRD:01091HPRD12782713
GORS2_HUMANyeast 2-hybridHPRD:01091HPRD16189514
MIF_HUMANin vitroHPRD:01091HPRD10353846
11170644
11997397
8610159
STRN4_HUMANyeast 2-hybridHPRD:01091HPRD16169070
HG2A_HUMANENSP00000215754STRING
AATM_HUMANENSP00000215754STRING
AATM_HUMANENSP00000215754STRING
HPPD_HUMANENSP00000215754STRING
IL8_HUMANENSP00000215754STRING
K2C7_HUMANENSP00000215754STRING
ATTY_HUMANENSP00000215754STRING
- top -

Disease Reference
Kegg disease
OMIM disease
604302Rheumatoid arthritis systemic juvenile (RASJ)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-78, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells.";
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.;
Nat. Biotechnol. 23:94-101(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-37, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures