Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myosin regulatory light chain 2  

UniProtKB / Swiss-Prot ID :  MLR_DROME

Gene Name (Synonyms) : 
Mlc2 CG2184  

Species :  Drosophila melanogaster (Fruit fly). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MADEKKKVKKKKTKEEGGTSETASEAASEAATPAPAATPAPAASATGSKRASGGSRGSRKSKRAGSSVFS...
Predicted Secondary Structure CCHHHHHHHHHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADEKK
---CCHHHH
33.40UniProtKB
Link-
66Phosphoserine (Mlck_drome)KRAGSSVFS
HHHHHHHHH
23.50PhosphoELM
Link-
66Phosphoserine.KRAGSSVFS
HHHHHHHHH
23.50UniProtKB
Link-
67Phosphoserine (Mlck_drome)RAGSSVFSV
HHHHHHHHC
26.68PhosphoELM
Link-
67Phosphoserine.RAGSSVFSV
HHHHHHHHC
26.68UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos.";
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
J. Proteome Res. 7:1675-1682(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66 AND SER-67, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures