Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Collagenase 3  

UniProtKB / Swiss-Prot ID :  MMP13_HUMAN

Gene Name (Synonyms) : 
MMP13  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted, extracellular space, extracellular matrix (Probable). 

Protein Function :  Degrades collagen type I. Does not act on gelatin or casein. Could have a role in tumoral process. 

Protein Sequence MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLRE...
Predicted Secondary Structure CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHH...
Protein Variant
LocationDescription
2H -> L (in dbSNP:rs554797). VAR_011971
74F -> S (in MANDP1). VAR_063432
75F -> S (in SEMD-MO; abnormalintracellular autoactivation and
91M -> T (in MANDP1). VAR_063433
232H -> N (in MANDP1). VAR_063434
390D -> G (in dbSNP:rs17860568). VAR_020534
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
54noneTNLAGILKE
CCCCCCCCC
29.00HPRD
Link-
103nonePDVGEYNVF
CCCCCCEEC
33.51HPRD
Link
360PhosphotyrosineALNGYDILE
EECCCCCCC
9.95Phosphositeplus
Link-
366PhosphotyrosineILEGYPKKI
CCCCCCCCC
11.51Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
LRP1_HUMANin vitro
in vivo
HPRD:02522HPRD10514495
CO2A1_HUMANin vitroHPRD:02522HPRD8609233
CCL7_HUMANin vitro
in vivo
HPRD:02522HPRD12149192
10947989
TIMP3_HUMANin vitroHPRD:02522HPRD9065415
FA12_HUMANin vivoHPRD:02522HPRD10930399
PGCB_HUMANin vitroHPRD:02522HPRD10986281
MMP13_HUMANin vitroHPRD:02522HPRD10074939
- top -

Disease Reference
Kegg disease
OMIM disease
602111Spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO)
602111Metaphyseal anadysplasia 1 (MANDP1)
250400Metaphyseal dysplasia, Spahr type (MDST)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures